human Notch 1, EGF 4-7. Determined by X-ray diffraction at 2.92 Å resolution. Released 20 Apr 2016.
Explore 5FM9 in 3D Show helices and sheets RCSB PDB PDBe
5FM9 contains 7 α-helices and 14 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 143-146 | 4 | |
| β-strand | 154-158 | 5 | 1 |
| β-strand | 161-165 | 5 | 1 |
| β-strand | 170-171 | 2 | 2 |
| β-strand | 177-178 | 2 | 2 |
| α-helix | 179 | 1 | |
| α-helix | 181-184 | 4 | |
| α-helix | 193 | 1 | |
| β-strand | 194-198 | 5 | 3 |
| β-strand | 201-205 | 5 | 3 |
| β-strand | 210-211 | 2 | 4 |
| β-strand | 217-218 | 2 | 4 |
| α-helix | 219 | 1 | |
| β-strand | 232-233 | 2 | 5 |
| β-strand | 243-244 | 2 | 5 |
| α-helix | 245-246 | 2 | |
| β-strand | 249-250 | 2 | 6 |
| β-strand | 256-257 | 2 | 6 |
| α-helix | 270 | 1 | |
| β-strand | 271-274 | 4 | 7 |
| β-strand | 279-282 | 4 | 7 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Neurogenic locus notch homolog protein 1 | A | protein | 157 | HOMO SAPIENS | P46531 (AlphaFold model) |
>5FM9_1 NEUROGENIC LOCUS NOTCH HOMOLOG PROTEIN 1 (chains A) SAQADPCASNPCANGGQCLPFEASYICHCPPSFHGPTCRQDVNECGQKPGLCRHGGTCHN EVGSYRCVCRATHTGPNCERPYVPCSPSPCQNGGTCRPTGDVTHECACLPGFTGQNCEEN IDDCPGNNCKNGGACVDGVNTYNCRCPPEWTGQYCTE
| ID | Name | Formula | Copies |
|---|---|---|---|
| CA | Calcium ion | Ca | 2 |
Non-Linear and Flexible Regions of the Human Notch1 Extracellular Domain Revealed by High-Resolution Structural Studies. Weisshuhn, P.C., Sheppard, D., Taylor, P. et al. Structure (2016) 24:555. DOI 10.1016/J.STR.2016.02.010 · PubMed
Other PDB entries of the same protein (UniProt P46531 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 5FM9 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.