5FMK: Bcl-xL with Bak BH3 complex

Bcl-xL with Bak BH3 complex. Determined by X-ray diffraction at 1.73 Å resolution. Released 1 Jun 2016.

Method: X-ray diffraction
Resolution: 1.73 Å
Organism: HOMO SAPIENS
Chains: 2
Atoms: 1,542
Mol. weight: 22.14 kDa
Released: 1 Jun 2016

Explore 5FMK in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

5FMK contains 12 α-helices and 0 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 11 helices, 0 β-strands

Element	Residues	Length
α-helix	59-75	17
α-helix	82-105	24
α-helix	108-111	4
α-helix	116-118	3
α-helix	119-130	12
α-helix	137-156	20
α-helix	161-173	13
α-helix	174-178	5
α-helix	179-184	6
α-helix	187-195	9
α-helix	199-206	8

Chain B: 1 helix, 0 β-strands

Element	Residues	Length	Sheet
α-helix	70-85	16

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Bcl-xl	A	protein	158	HOMO SAPIENS	Q07817 (AlphaFold model)
Bcl-2 homologous antagonist/killer	B	protein	34	HOMO SAPIENS	Q16611 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>5FMK_1 BCL-XL (chains A)
GPLGSMSQSNRELVVDFLSYKLSQKGYSWSQMAAVKQALREAGDEFELRYRRAFSDLTSQ
LHITPGTAYQSFEQVVNELFRDGVNWGRIVAFFSFGGALCVESVDKEMQVLVSRIASWMA
TYLNDHLEPWIQENGGWDTFVELYGNNAAAESRKGQER

Sequence of entity 2 (B), FASTA

>5FMK_2 BCL-2 HOMOLOGOUS ANTAGONIST/KILLER (chains B)
LPLQPSSTMGQVGRQLAIIGDDINRRYDSEFQTM

Primary citation

Physiological Restraint of Bak by Bcl-Xl is Essential for Cell Survival. Lee, E.F., Grabow, S., Chappaz, S. et al. Genes Dev (2016) 30:1240. DOI 10.1101/GAD.279414.116 · PubMed

Other PDB entries of the same protein (UniProt Q07817 (AlphaFold model), which also has an AlphaFold model), best resolution first:

7JGW 1.3 Å, Crystal structure of BCL-XL in complex with COMPOUND 1620116, CRYSTAL FORM 1
3SP7 1.4 Å, Crystal Structure of Bcl-xL bound to BM903
7YAA 1.4 Å, Crystal structure analysis of cp3 bound BCLxl
7LH7 1.41 Å, Crystal structure of BCL-XL in complex with a benzothiazole-based inhibitor
9IGG 1.5 Å, Structure of human Bcl-xL in complex with small molecule inhibitor
4QVF 1.53 Å, Crystal structure of Bcl-xL in complex with BIM BH3 domain
4A1U 1.54 Å, Crystal structure of alpha-beta-foldamer 2c in complex with Bcl-xL
6VWC 1.6 Å, Crystal structure of Bcl-xL in complex with tetrahydroisoquinoline-pyridine based…
6O0K 1.62 Å, crystal structure of BCL-2 with venetoclax
3SPF 1.7 Å, Crystal Structure of Bcl-xL bound to BM501
9I9E 1.7 Å, Structure of human Bcl-xL in complex with small molecule inhibitor
9O14 1.73 Å, Crystal Structure of BCL-2 in complex with a stapled BAD BH3 peptide BAD SAHB 4.2

Browse structure collections

About this viewer

MolViewer shows 5FMK directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.