Crystal structure of human CD45 extracellular region, domains d1-d3. Determined by X-ray diffraction at 3.3 Å resolution. Released 23 Mar 2016.
Explore 5FN6 in 3D Show helices and sheets RCSB PDB PDBe
5FN6 contains 10 α-helices and 22 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 11-14 | 4 | |
| β-strand | 19-25 | 7 | 1 |
| β-strand | 30-36 | 7 | 1 |
| β-strand | 42-43 | 2 | 2 |
| α-helix | 49-51 | 3 | |
| β-strand | 52-56 | 5 | 1 |
| α-helix | 57 | 1 | |
| β-strand | 61-67 | 7 | 2 |
| α-helix | 72 | 1 | |
| α-helix | 75 | 1 | |
| β-strand | 76-81 | 6 | 2 |
| α-helix | 86-88 | 3 | |
| β-strand | 89-93 | 5 | 3 |
| α-helix | 97-99 | 3 | |
| β-strand | 104-110 | 7 | 3 |
| α-helix | 118-120 | 3 | |
| β-strand | 121-126 | 6 | 4 |
| β-strand | 131-133 | 3 | 4 |
| β-strand | 136-139 | 4 | 3 |
| α-helix | 142-143 | 2 | |
| β-strand | 147-156 | 10 | 4 |
| β-strand | 159-169 | 11 | 4 |
| β-strand | 179-187 | 9 | 5 |
| β-strand | 190-196 | 7 | 5 |
| β-strand | 204-211 | 8 | 6 |
| β-strand | 214-217 | 4 | 6 |
| β-strand | 220-221 | 2 | 6 |
| β-strand | 226-229 | 4 | 5 |
| β-strand | 237-247 | 11 | 6 |
| β-strand | 251-253 | 3 | 6 |
| α-helix | 254-256 | 3 | |
| β-strand | 257-262 | 6 | 6 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Receptor-type tyrosine-protein phosphatase C | A | protein | 269 | HOMO SAPIENS | P08575 (AlphaFold model) |
>5FN6_1 RECEPTOR-TYPE TYROSINE-PROTEIN PHOSPHATASE C (chains A) ETGKPTCDEKYANITVDYLYNKETKLFTAKLNVNENVECGNNTCTNNEVHNLTECKNASV SISHNSCTAPDKTLILDVPPGVEKFQLHDCTQVEKADTTICLKWKNIETFTCDTQNITYR FQCGNMIFDNKEIKLENLEPEHEYKCDSEILYNNHKFTNASKIIKTDFGSPGEPQIIFCR SEAAHQGVITWNPPQRSFHNFTLCYIKETEKDCLNLDKNLIKYDLQNLKPYTKYVLSLHA YIIAKVQRNGSAAMCHFTTKGTKHHHHHH
| ID | Name | Formula | Copies |
|---|---|---|---|
| NAG | 2-acetamido-2-deoxy-beta-D-glucopyranose | C8 H15 N O6 | 5 |
Initiation of T Cell Signaling by Cd45 Segregation at 'Close Contacts'. Chang, V.T., Fernandes, R.A., Ganzinger, K.A. et al. Nat Immunol (2016) 17:574. DOI 10.1038/NI.3392 · PubMed
Other PDB entries of the same protein (UniProt P08575 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 5FN6 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.