Human Spectrin SH3 domain D48G, E7F, K60F. Determined by X-ray diffraction at 1.5 Å resolution. Released 28 Dec 2016.
Explore 5FWB in 3D Show helices and sheets RCSB PDB PDBe
5FWB contains 1 α-helix and 8 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 8-11 | 4 | 1 |
| β-strand | 15 | 1 | 2 |
| β-strand | 22 | 1 | 1 |
| β-strand | 25 | 1 | 2 |
| β-strand | 30-35 | 6 | 1 |
| β-strand | 41-46 | 6 | 1 |
| β-strand | 49-54 | 6 | 1 |
| α-helix | 55-57 | 3 | |
| β-strand | 58-60 | 3 | 1 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Spectrin alpha chain, non-erythrocytic 1 | A | protein | 62 | HOMO SAPIENS | Q13813 (AlphaFold model) |
>5FWB_1 SPECTRIN ALPHA CHAIN, NON-ERYTHROCYTIC 1 (chains A) MDETGKFLVLALYDYQEKSPREVTMKKGDILTLLNSTNKDWWKVEVNGRQGFVPAAYVKF LD
Human Spectrin SH3 Domain D48G, E7F, K60F. Navarro, S., Gallego, P., Diaz, M. et al. To be published.
Other PDB entries of the same protein (UniProt Q13813 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 5FWB directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.