5FWU: Wnt modulator Kremen crystal form II

Wnt modulator Kremen crystal form II at 2.8A. Determined by X-ray diffraction at 2.8 Å resolution. Released 20 Jul 2016.

Method: X-ray diffraction
Resolution: 2.8 Å
Organism: HOMO SAPIENS
Chains: 1
Atoms: 2,132
Mol. weight: 45.07 kDa
Ligands: NAG
Released: 20 Jul 2016

Explore 5FWU in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

5FWU contains 9 α-helices and 22 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 9 helices, 22 β-strands

Element	Residues	Length	Sheet
β-strand	46	1	1
α-helix	52-53	2
β-strand	54	1	1
α-helix	55-57	3
α-helix	75-77	3
β-strand	85	1	2
β-strand	94-96	3	2
β-strand	106-108	3	2
β-strand	119-124	6	3
α-helix	130	1
β-strand	135-138	4	3
α-helix	144-154	11
β-strand	158-162	5	3
β-strand	166-170	5	3
β-strand	180-181	2	3
α-helix	183-186	4
α-helix	188	1
β-strand	189	1	4
α-helix	190	1
β-strand	197	1	4
β-strand	203-208	6	3
β-strand	216-218	3	5
β-strand	222-226	5	6
α-helix	227	1
β-strand	240-245	6	5
β-strand	251-259	9	6
β-strand	267-272	6	5
β-strand	278-283	6	5
β-strand	291-294	4	6
β-strand	298-303	6	5
β-strand	314-321	8	6

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Kremen protein 1	A	protein	406	HOMO SAPIENS	Q96MU8 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>5FWU_1 KREMEN PROTEIN 1 (chains A)
MGILPSPGMPALLSLVSLLSVLLMGCVAETGAPSPGLGPGPECFTANGADYRGTQNWTAL
QGGKPCLFWNETFQHPYNTLKYPNGEGGLGEHNYCRNPDGDVSPWCYVAEHEDGVYWKYC
EIPACQMPGNLGCYKDHGNPPPLTGTSKTSNKLTIQTCISFCRSQRFKFAGMESGYACFC
GNNPDYWKYGEAASTECNSVCFGDHTQPCGGDGRIILFDTLVGACGGNYSAMSSVVYSPD
FPDTYATGRVCYWTIRVPGASHIHFSFPLFDIRDSADMVELLDGYTHRVLARFHGRSRPP
LSFNVSLDFVILYFFSDRINQAQGFAVLYQAVKEEGSENLYFQGGSLPQERPAVNQTVAE
VITEQANLSVSAARSSKVLYVITTSPSHPPQTVPGTHHHHHHHHHH

Ligands and cofactors

ID	Name	Formula	Copies
NAG	2-acetamido-2-deoxy-beta-D-glucopyranose	C8 H15 N O6	2

Water and common crystallization additives (CL) are not listed.

Primary citation

Structure of the Dual-Mode Wnt Regulator Kremen1 and Insight Into Ternary Complex Formation with Lrp6 and Dickkopf. Zebisch, M., Jackson, V.A., Zhao, Y. et al. Structure (2016) 24:1599. DOI 10.1016/J.STR.2016.06.020 · PubMed

Other PDB entries of the same protein (UniProt Q96MU8 (AlphaFold model), which also has an AlphaFold model), best resolution first:

5FWS 1.9 Å, Wnt modulator Kremen crystal form I at 1.90A
5FWT 2.1 Å, Wnt modulator Kremen crystal form I at 2.10A
9VFR 2.55 Å, Structure of mature Coxsackievirus A6 virion complexed with its receptor KREMEN1
7BZT 3.0 Å, Cryo-EM structure of mature Coxsackievirus A10 in complex with KRM1 at pH 7.4
7BZU 3.0 Å, Cryo-EM structure of mature Coxsackievirus A10 in complex with KRM1 at pH 5.5
5FWV 3.2 Å, Wnt modulator Kremen crystal form III at 3.2A
5FWW 3.5 Å, Wnt modulator Kremen in complex with DKK1 (CRD2) and LRP6 (PE3PE4)
6SNW 3.9 Å, Structure of Coxsackievirus A10 complexed with its receptor KREMEN1

Browse structure collections

About this viewer

MolViewer shows 5FWU directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.