5FWW: Wnt modulator Kremen

Wnt modulator Kremen in complex with DKK1 (CRD2) and LRP6 (PE3PE4). Determined by X-ray diffraction at 3.5 Å resolution. Released 20 Jul 2016.

Method: X-ray diffraction
Resolution: 3.5 Å
Organism: HOMO SAPIENS
Chains: 3
Atoms: 7,730
Mol. weight: 112.47 kDa
Ligands: CA
Released: 20 Jul 2016

Explore 5FWW in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

5FWW contains 21 α-helices and 98 β-strands across 3 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 9 helices, 59 β-strands

Element	Residues	Length	Sheet
α-helix	631-632	2
β-strand	633-638	6	1
β-strand	639	1	2
β-strand	641-645	5	1
β-strand	653-655	3	1
β-strand	664-670	7	2
β-strand	675-680	6	2
β-strand	685-690	6	2
β-strand	697-700	4	2
β-strand	709-713	5	3
β-strand	718-723	6	3
β-strand	728-733	6	3
β-strand	740-743	4	3
β-strand	750-756	7	4
β-strand	761-766	6	4
β-strand	772-777	6	4
β-strand	784-787	4	4
β-strand	793-799	7	5
β-strand	804-809	6	5
β-strand	814-819	6	5
β-strand	826-829	4	5
β-strand	835-841	7	6
β-strand	844-849	6	6
β-strand	854-859	6	6
β-strand	867-871	5	6
β-strand	879-882	4	1
α-helix	892-894	3
α-helix	896-899	4
β-strand	903-906	4	7
β-strand	912-915	4	7
α-helix	920	1
β-strand	921-922	2	8
α-helix	923	1
β-strand	929-930	2	8
β-strand	935-939	5	9
β-strand	944-947	4	9
α-helix	954-956	3
β-strand	957-958	2	9
β-strand	967-973	7	10
β-strand	978-983	6	10
β-strand	988-992	5	10
β-strand	1000-1003	4	10
β-strand	1016-1022	7	11
β-strand	1027-1032	6	11
β-strand	1037-1042	6	11
β-strand	1047-1053	7	11
β-strand	1059-1065	7	12
β-strand	1070-1076	7	12
β-strand	1081-1086	6	12
β-strand	1094-1097	4	12
β-strand	1104-1110	7	13
β-strand	1115-1120	6	13
β-strand	1125-1130	6	13
β-strand	1137-1140	4	13
β-strand	1147-1153	7	14
β-strand	1156-1161	6	14
β-strand	1166-1171	6	14
β-strand	1179-1183	5	14
β-strand	1190-1194	5	9
α-helix	1195-1197	3
α-helix	1199-1203	5
α-helix	1210-1213	4
β-strand	1217	1	15
β-strand	1220	1	16
β-strand	1226	1	16
β-strand	1229	1	15
β-strand	1235-1236	2	17
β-strand	1243-1244	2	17

Chain B: 9 helices, 28 β-strands

Element	Residues	Length	Sheet
β-strand	46	1	18
β-strand	48	1	19
β-strand	54	1	18
α-helix	55-57	3
α-helix	58-60	3
α-helix	75-77	3
β-strand	85	1	20
β-strand	94-96	3	20
β-strand	106-108	3	20
β-strand	110	1	19
β-strand	119-124	6	21
β-strand	135-138	4	21
α-helix	144-153	10
β-strand	158-162	5	21
β-strand	166-170	5	21
β-strand	180	1	21
α-helix	183-186	4
β-strand	187	1	22
α-helix	188	1
β-strand	189	1	23
α-helix	190	1
β-strand	197	1	23
β-strand	199	1	22
β-strand	200	1	21
β-strand	203-208	6	21
β-strand	216-218	3	24
β-strand	222-226	5	25
α-helix	227	1
α-helix	233-235	3
β-strand	239-245	7	24
β-strand	251-260	10	25
β-strand	267-272	6	24
β-strand	278-283	6	24
β-strand	286	1	24
β-strand	291-294	4	25
β-strand	298-304	7	24
β-strand	313-321	9	25

Chain C: 3 helices, 11 β-strands

Element	Residues	Length	Sheet
β-strand	183	1	26
β-strand	188	1	27
β-strand	195	1	26
β-strand	199-204	6	27
β-strand	207-212	6	27
α-helix	213	1
β-strand	214	1	28
β-strand	219-220	2	29
α-helix	227-231	5
β-strand	234	1	27
α-helix	235-238	4
β-strand	239	1	28
β-strand	244-247	4	29
β-strand	261-264	4	29

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Low-density lipoprotein receptor-related protein 6	A	protein	619	HOMO SAPIENS	O75581 (AlphaFold model)
Kremen protein 1	B	protein	293	HOMO SAPIENS	Q96MU8 (AlphaFold model)
Dickkopf-related protein 1	C	protein	85	HOMO SAPIENS	O94907 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>5FWW_1 LOW-DENSITY LIPOPROTEIN RECEPTOR-RELATED PROTEIN 6 (chains A)
ADPEAFLLFSRRADIRRISLETNNNNVAIPLTGVKEASALDFDVTDNRIYWTDISLKTIS
RAFMNGSALEHVVEFGLDYPEGMAVDWLGKNLYWADTGTNRIEVSKLDGQHRQVLVWKDL
DSPRALALDPAEGFMYWTEWGGKPKIDRAAMDGSERTTLVPNVGRANGLTIDYAKRRLYW
TDLDTNLIESSNMLGLNREVIADDLPHPFGLTQYQDYIYWTDWSRRSIERANKTSGQNRT
IIQGHLDYVMDILVFHSSRQSGWNECASSNGHCSHLCLAVPVGGFVCGCPAHYSLNADNR
TCSAPTTFLLFSQKSAINRMVIDEQQSPDIILPIHSLRNVRAIDYDPLDKQLYWIDSRQN
MIRKAQEDGSQGFTVVVSSVPSQNLEIQPYDLSIDIYSRYIYWTCEATNVINVTRLDGRS
VGVVLKGEQDRPRAIVVNPEKGYMYFTNLQERSPKIERAALDGTEREVLFFSGLSKPIAL
ALDSRLGKLFWADSDLRRIESSDLSGANRIVLEDSNILQPVGLTVFENWLYWIDKQQQMI
EKIDMTGREGRTKVQARIAQLSDIHAVKELNLQEYRQHPCAQDNGGCSHICLVKGDGTTR
CSCPMHLVLLQDELSCGEP

Sequence of entity 2 (B), FASTA

>5FWW_2 KREMEN PROTEIN 1 (chains B)
PECFTANGADYRGTQNWTALQGGKPCLFWNETFQHPYNTLKYPNGEGGLGEHNYCRNPDG
DVSPWCYVAEHEDGVYWKYCEIPACQMPGNLGCYKDHGNPPPLTGTSKTSNKLTIQTCIS
FCRSQRFKFAGMESGYACFCGNNPDYWKYGEAASTECNSVCFGDHTQPCGGDGRIILFDT
LVGACGGNYSAMSSVVYSPDFPDTYATGRVCYWTIRVPGASHIHFSFPLFDIRDSADMVE
LLDGYTHRVLARFHGRSRPPLSFNVSLDFVILYFFSDRINQAQGFAVLYQAVK

Sequence of entity 3 (C), FASTA

>5FWW_3 DICKKOPF-RELATED PROTEIN 1 (chains C)
KGQEGSVCLRSSDCASGLCCARHFWSKICKPVLKEGQVCTKHRRKGSHGLEIFQRCYCGE
GLSCRIQKDHHQASNSSRLHTCQRH

Ligands and cofactors

ID	Name	Formula	Copies
CA	Calcium ion	Ca	1

Primary citation

Structure of the Dual-Mode Wnt Regulator Kremen1 and Insight Into Ternary Complex Formation with Lrp6 and Dickkopf. Zebisch, M., Jackson, V.A., Zhao, Y. et al. Structure (2016) 24:1599. DOI 10.1016/J.STR.2016.06.020 · PubMed

Other PDB entries of the same protein (UniProt O75581 (AlphaFold model), which also has an AlphaFold model), best resolution first:

3SOV 1.27 Å, The structure of a beta propeller domain in complex with peptide S
7NAM 1.6 Å, LRP6_E1 in complex with Lr-EET-3.5
8FFE 1.72 Å, Crystal structure of LRP6 E1E2 domains bound to YW210.09 Fab and engineered XWnt8 peptide
3SOB 1.9 Å, The structure of the first YWTD beta propeller domain of LRP6 in complex with a FAB
3SOQ 1.9 Å, The structure of the first YWTD beta propeller domain of LRP6 in complex with a DKK1…
4A0P 1.9 Å, Crystal structure of LRP6P3E3P4E4
8DVM 2.0 Å, Crystal structure of LRP6 E3E4 in complex with disulfide constrained peptide E3.6
4NM5 2.3 Å, Crystal structure of GSK-3/Axin complex bound to phosphorylated Wnt receptor LRP6 c-motif
4NM7 2.3 Å, Crystal structure of GSK-3/Axin complex bound to phosphorylated Wnt receptor LRP6 e-motif
8DVL 2.5 Å, Crystal structure of LRP6 E3E4 in complex with disulfide constrained peptide E3.18
5AIR 2.53 Å, Structural analysis of mouse GSK3beta fused with LRP6 peptide.
8DVN 2.53 Å, Crystal structure of LRP6 E3E4 in complex with disulfide constrained peptide E3.10

Browse structure collections

About this viewer

MolViewer shows 5FWW directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.