5GT7: Arg-bound CASTOR1

Crystal Structure of Arg-bound CASTOR1. Determined by X-ray diffraction at 2.05 Å resolution. Released 23 Aug 2017.

Method: X-ray diffraction
Resolution: 2.05 Å
Organism: Homo sapiens
Chains: 4
Atoms: 10,138
Mol. weight: 148.72 kDa
Ligands: ARG, MLI
Released: 23 Aug 2017

Explore 5GT7 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

5GT7 contains 76 α-helices and 83 β-strands across 4 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 19 helices, 23 β-strands

Element	Residues	Length	Sheet
β-strand	1-15	15	1
α-helix	17-23	7
α-helix	24-32	9
α-helix	34-36	3
β-strand	41-46	6	1
β-strand	51-56	6	1
α-helix	57-60	4
β-strand	69-71	3	1
β-strand	76-83	8	1
α-helix	84-86	3
β-strand	87-88	2	1
α-helix	89-90	2
β-strand	93	1	2
α-helix	95-97	3
α-helix	98-102	5
α-helix	103-107	5
β-strand	112-116	5	1
β-strand	121-126	6	1
α-helix	127-129	3
α-helix	130-137	8
β-strand	141-145	5	1
β-strand	147	1	3
β-strand	150	1	3
β-strand	153	1	1
α-helix	166-172	7
β-strand	177-178	2	1
β-strand	184-187	4	1
β-strand	188	1	4
α-helix	191-193	3
α-helix	194-206	13
β-strand	228-233	6	1
β-strand	236-242	7	1
α-helix	243-246	4
α-helix	250	1
β-strand	255	1	4
β-strand	263-268	6	1
α-helix	280-290	11
β-strand	295	1	2
β-strand	296-299	4	1
β-strand	304-309	6	1
α-helix	310-312	3
α-helix	313-321	9

Chain B: 20 helices, 21 β-strands

Element	Residues	Length	Sheet
β-strand	2-16	15	5
α-helix	17-23	7
α-helix	24-32	9
α-helix	34-36	3
β-strand	41-46	6	5
β-strand	50-56	7	5
α-helix	57-61	5
β-strand	69-71	3	5
β-strand	76-82	7	5
α-helix	87	1
β-strand	88	1	5
α-helix	89-90	2
β-strand	93	1	6
α-helix	95-97	3
α-helix	98-102	5
α-helix	103-107	5
β-strand	112-116	5	5
β-strand	121-126	6	5
α-helix	127-129	3
α-helix	130-137	8
β-strand	142-147	6	5
β-strand	150-152	3	5
α-helix	170-172	3
β-strand	177-178	2	5
α-helix	182-183	2
β-strand	184-187	4	5
β-strand	188	1	7
α-helix	191-193	3
α-helix	194-206	13
β-strand	228-233	6	5
β-strand	236-242	7	5
α-helix	243-246	4
α-helix	250	1
β-strand	255	1	7
β-strand	263-268	6	5
α-helix	280-290	11
β-strand	295	1	6
β-strand	296-299	4	5
β-strand	304-309	6	5
α-helix	310-312	3
α-helix	313-321	9

Chain C: 19 helices, 19 β-strands

Element	Residues	Length	Sheet
β-strand	1-16	16	8
α-helix	17-23	7
α-helix	24-32	9
α-helix	34-36	3
β-strand	41-46	6	8
β-strand	50-56	7	8
α-helix	57-60	4
β-strand	69-71	3	8
β-strand	76-81	6	8
β-strand	93	1	9
α-helix	94-97	4
α-helix	98-102	5
α-helix	103-107	5
β-strand	112-116	5	8
β-strand	121-126	6	8
α-helix	127-129	3
α-helix	130-137	8
β-strand	141-147	7	8
β-strand	150-153	4	8
α-helix	170-172	3
α-helix	174-176	3
β-strand	177-178	2	8
β-strand	184-188	5	8
α-helix	191-193	3
α-helix	194-206	13
α-helix	211-213	3
β-strand	228-233	6	8
β-strand	236-242	7	8
α-helix	245-248	4
α-helix	250	1
β-strand	255-256	2	8
β-strand	263-268	6	8
α-helix	280-290	11
β-strand	295	1	9
β-strand	296-299	4	8
β-strand	304-309	6	8
α-helix	310-312	3
α-helix	313-320	8

Chain D: 18 helices, 20 β-strands

Element	Residues	Length	Sheet
β-strand	2-15	14	10
α-helix	17-23	7
α-helix	24-32	9
α-helix	34-36	3
β-strand	41-46	6	10
β-strand	51-56	6	10
α-helix	57-60	4
β-strand	69-71	3	10
β-strand	76-81	6	10
α-helix	82-83	2
β-strand	93	1	11
α-helix	94-97	4
α-helix	98-102	5
α-helix	103-107	5
β-strand	112-116	5	10
β-strand	121-126	6	10
α-helix	127-129	3
α-helix	130-137	8
β-strand	142-146	5	10
β-strand	151-153	3	10
α-helix	173-176	4
β-strand	177-178	2	10
β-strand	183-187	5	10
β-strand	188	1	12
α-helix	191-193	3
α-helix	194-206	13
β-strand	228-233	6	10
β-strand	236-242	7	10
α-helix	243-246	4
α-helix	250	1
β-strand	255	1	12
β-strand	263-268	6	10
α-helix	280-290	11
β-strand	295	1	11
β-strand	296-299	4	10
β-strand	304-309	6	10
α-helix	310-312	3
α-helix	313-320	8

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
GATS-like protein 3	A, B, C, D	protein	335	Homo sapiens	Q8WTX7 (AlphaFold model)

Sequence of entity 1 (A, B, C, D), FASTA

>5GT7_1 GATS-like protein 3 (chains A, B, C, D)
AGSGHMMELHILEHRVRVLSVARPGLWLYTHPLIKLLFLPRRSRCKFFSLTETPEDYTLM
VDEEGFKELPPSEFLQVAEATWLVLNVSSHSGAAVQAAGVTKIARSVIAPLAEHHVSVLM
LSTYQTDFILVREQDLSVVIHTLAQEFDIYREVGGEPVPVTRDDSSNGFPRTQHGPSPTV
HPIQSPQNRFCVLTLDPETLPAIATTLIDVLFYSHSTPKEAASSSPEPSSITFFAFSLIE
GYISIVMDAETQKKFPSDLLLTSSSGELWRMVRIGGQPLGFDECGIVAQIAGPLAAADIS
AYYISTFNFDHALVPEDGIGSVIEVLQRRQEGLAS

Ligands and cofactors

ID	Name	Formula	Copies
ARG	Arginine	C6 H15 N4 O2	4
MLI	Malonate ion	C3 H2 O4	6

Primary citation

Crystal structures of arginine sensor CASTOR1 in arginine-bound and ligand free states. Zhou, Y., Wang, C., Xiao, Q. et al. Biochem Biophys Res Commun (2019) 508:387-391. DOI 10.1016/j.bbrc.2018.11.147 · PubMed

Other PDB entries of the same protein (UniProt Q8WTX7 (AlphaFold model), which also has an AlphaFold model), best resolution first:

9PDO 1.8 Å, Arginine-bound CASTOR1 from Homo sapiens (GATOR2-inspired update)
5I2C 1.8 Å, Arginine-bound CASTOR1 from Homo sapiens
5GV2 2.06 Å, Crystal structure of Arginine-bound CASTOR1 from Homo sapiens
5GS9 2.5 Å, Crystal structure of CASTOR1-arginine
5GT8 2.8 Å, Crystal Structure of apo-CASTOR1
9KP4 3.08 Å, Crystal structure of human CASTOR1 in apo form
9DX2 3.4 Å, Human GATOR2 complex - CASTOR1 bound state
9LWF 3.41 Å, Cryo-EM structure of dual sensor bound GATOR2 complex
9OTI 3.5 Å, GATOR2 complex bound to arginine sensor CASTOR1
9LVK 3.59 Å, Cryo-EM structure of CASTOR1 bound human GATOR2 complex

Browse structure collections

About this viewer

MolViewer shows 5GT7 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.