5GT8: Apo-CASTOR1

Crystal Structure of apo-CASTOR1. Determined by X-ray diffraction at 2.8 Å resolution. Released 23 Aug 2017.

Method: X-ray diffraction
Resolution: 2.8 Å
Organism: Homo sapiens
Chains: 4
Atoms: 8,282
Mol. weight: 147.45 kDa
Released: 23 Aug 2017

Explore 5GT8 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

5GT8 contains 59 α-helices and 67 β-strands across 4 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 14 helices, 17 β-strands

Element	Residues	Length	Sheet
β-strand	2-15	14	1
α-helix	17-23	7
α-helix	24-32	9
β-strand	41-46	6	1
β-strand	51-56	6	1
α-helix	57-60	4
β-strand	69-71	3	1
β-strand	76-82	7	1
α-helix	97	1
α-helix	98-102	5
α-helix	103-107	5
β-strand	113-116	4	1
β-strand	121-126	6	1
α-helix	127-137	11
β-strand	142-147	6	1
β-strand	150-153	4	1
β-strand	177-178	2	1
β-strand	184-189	6	1
α-helix	191-193	3
α-helix	195-206	12
β-strand	228-233	6	1
β-strand	236-242	7	1
α-helix	243-246	4
α-helix	250	1
β-strand	255-256	2	1
β-strand	263-268	6	1
α-helix	282-290	9
β-strand	296-299	4	1
β-strand	304-309	6	1
α-helix	310-312	3
α-helix	313-322	10

Chain B: 16 helices, 17 β-strands

Element	Residues	Length	Sheet
β-strand	2-16	15	1
α-helix	17-19	3
α-helix	21-23	3
α-helix	24-32	9
β-strand	41-46	6	1
β-strand	50-56	7	1
α-helix	57-60	4
β-strand	69-71	3	1
β-strand	76-82	7	1
α-helix	98-102	5
α-helix	103-107	5
β-strand	113-116	4	1
β-strand	121-126	6	1
α-helix	127-129	3
α-helix	130-137	8
β-strand	142-147	6	1
β-strand	150-153	4	1
β-strand	178	1	1
β-strand	184-188	5	1
α-helix	191-193	3
α-helix	194-202	9
α-helix	203-207	5
β-strand	228-233	6	1
β-strand	236-242	7	1
α-helix	243-246	4
α-helix	250	1
β-strand	255-256	2	1
β-strand	263-269	7	1
α-helix	281-290	10
β-strand	296-299	4	1
β-strand	303-309	7	1
α-helix	310-312	3
α-helix	313-319	7

Chain C: 15 helices, 17 β-strands

Element	Residues	Length	Sheet
β-strand	2-5	4	2
β-strand	10-15	6	2
α-helix	17-23	7
α-helix	24-32	9
α-helix	34-36	3
β-strand	41-47	7	2
β-strand	50-56	7	2
α-helix	57-60	4
β-strand	69-71	3	2
β-strand	76-82	7	2
α-helix	97	1
α-helix	98-102	5
α-helix	103-107	5
β-strand	112-116	5	2
β-strand	121-126	6	2
α-helix	130-135	6
β-strand	142-147	6	2
β-strand	150-152	3	2
β-strand	183-189	7	2
α-helix	191-193	3
α-helix	194-202	9
α-helix	203-207	5
β-strand	228-233	6	2
β-strand	236-242	7	2
α-helix	243-246	4
β-strand	255	1	2
β-strand	263-268	6	2
α-helix	280-289	10
β-strand	296-299	4	2
β-strand	304-308	5	2
α-helix	310-312	3
α-helix	313-322	10

Chain D: 14 helices, 16 β-strands

Element	Residues	Length	Sheet
β-strand	2-16	15	3
α-helix	17-23	7
α-helix	24-32	9
α-helix	34-36	3
β-strand	41-46	6	3
β-strand	50-56	7	3
α-helix	57-61	5
β-strand	69-71	3	3
β-strand	76-82	7	3
α-helix	102-106	5
β-strand	113-116	4	3
β-strand	121-126	6	3
α-helix	127-129	3
α-helix	130-135	6
β-strand	142-147	6	3
β-strand	150-153	4	3
β-strand	184-189	6	3
α-helix	191-193	3
α-helix	194-206	13
β-strand	228-233	6	3
β-strand	236-242	7	3
α-helix	245-248	4
β-strand	255	1	3
β-strand	263-269	7	3
α-helix	271-272	2
α-helix	285-288	4
β-strand	296-299	4	3
β-strand	303-309	7	3
α-helix	310-312	3
α-helix	313-318	6

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
GATS-like protein 3	A, B, C	protein	335	Homo sapiens	Q8WTX7 (AlphaFold model)
GATS-like protein 3	D	protein	335	Homo sapiens	Q8WTX7 (AlphaFold model)

Sequence of entity 1 (A, B, C), FASTA

>5GT8_1 GATS-like protein 3 (chains A, B, C)
AGSGHMMELHILEHRVRVLSVARPGLWLYTHPLIKLLFLPRRSRCKFFSLTETPEDYTLM
VDEEGFKELPPSEFLQVAEATWLVLNVSSHSGAAVQAAGVTKIARSVIAPLAEHHVSVLM
LSTYQTDFILVREQDLSVVIHTLAQEFDIYREVGGEPVPVTRDDSSNGFPRTQHGPSPTV
HPIQSPQNRFCVLTLDPETLPAIATTLIDVLFYSHSTPKEAASSSPEPSSITFFAFSLIE
GYISIVMDAETQKKFPSDLLLTSSSGELWRMVRIGGQPLGFDECGIVAQIAGPLAAADIS
AYYISTFNFDHALVPEDGIGSVIEVLQRRQEGLAS

Sequence of entity 2 (D), FASTA

>5GT8_2 GATS-like protein 3 (chains D)
AGSGHMMELHILEHRVRVLSVARPGLWLYTHPLIKLLFLPRRSRCKFFSLTETPEDYTLM
VDEEGFKELPPSEFLQVAEATWLVLNVSSHSGAAVQAAGVTKIARSVIAPLAEHHVSVLM
LSTYQTDFILVREQDLSVVIHTLAQEFDIYREVGGEPVPVTRDDSSNGFPRTQHGPSPTV
HPIQSPQNRFCVLTLDPETLPAIATTLIDVLFYSHSTPKEAASSSPEPSSITFFAFSLIE
GYISIVMDAETQKKFPSDLLLTSSSGELWRMVRIGGQPLGFDECGIVAQIIGPLAAADIS
AYYISTFNFDHALVPEDGIGSVIEVLQRRQEGLAS

Primary citation

Crystal structures of arginine sensor CASTOR1 in arginine-bound and ligand free states. Zhou, Y., Wang, C., Xiao, Q. et al. Biochem Biophys Res Commun (2019) 508:387-391. DOI 10.1016/j.bbrc.2018.11.147 · PubMed

Other PDB entries of the same protein (UniProt Q8WTX7 (AlphaFold model), which also has an AlphaFold model), best resolution first:

9PDO 1.8 Å, Arginine-bound CASTOR1 from Homo sapiens (GATOR2-inspired update)
5I2C 1.8 Å, Arginine-bound CASTOR1 from Homo sapiens
5GT7 2.05 Å, Crystal Structure of Arg-bound CASTOR1
5GV2 2.06 Å, Crystal structure of Arginine-bound CASTOR1 from Homo sapiens
5GS9 2.5 Å, Crystal structure of CASTOR1-arginine
9KP4 3.08 Å, Crystal structure of human CASTOR1 in apo form
9DX2 3.4 Å, Human GATOR2 complex - CASTOR1 bound state
9LWF 3.41 Å, Cryo-EM structure of dual sensor bound GATOR2 complex
9OTI 3.5 Å, GATOR2 complex bound to arginine sensor CASTOR1
9LVK 3.59 Å, Cryo-EM structure of CASTOR1 bound human GATOR2 complex

Browse structure collections

About this viewer

MolViewer shows 5GT8 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.