5GV2: Arginine-bound CASTOR1 from Homo sapiens

Crystal structure of Arginine-bound CASTOR1 from Homo sapiens. Determined by X-ray diffraction at 2.06 Å resolution. Released 6 Sept 2017.

Method: X-ray diffraction
Resolution: 2.06 Å
Organism: Homo sapiens
Chains: 2
Atoms: 4,955
Mol. weight: 77.3 kDa
Ligands: ARG, MG
Released: 6 Sept 2017

Explore 5GV2 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

5GV2 contains 34 α-helices and 40 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 17 helices, 20 β-strands

Element	Residues	Length	Sheet
β-strand	1-15	15	4
α-helix	17-23	7
α-helix	24-32	9
α-helix	34-36	3
β-strand	41-46	6	4
β-strand	51-56	6	4
α-helix	57-60	4
β-strand	69-71	3	4
β-strand	76-82	7	4
α-helix	87-89	3
β-strand	93	1	5
α-helix	95-97	3
α-helix	98-102	5
α-helix	103-107	5
β-strand	112-116	5	4
β-strand	121-126	6	4
α-helix	127-129	3
α-helix	130-137	8
β-strand	141-147	7	4
β-strand	150-153	4	4
β-strand	177-178	2	4
α-helix	182	1
β-strand	183-187	5	4
β-strand	188	1	6
α-helix	191-193	3
α-helix	194-206	13
β-strand	228-233	6	4
β-strand	236-242	7	4
α-helix	243-246	4
β-strand	254	1	6
β-strand	263-268	6	4
α-helix	280-290	11
β-strand	295	1	5
β-strand	296-299	4	4
β-strand	304-309	6	4
α-helix	310-312	3
α-helix	313-321	9

Chain C: 17 helices, 20 β-strands

Element	Residues	Length	Sheet
β-strand	2-15	14	1
α-helix	17-23	7
α-helix	24-32	9
α-helix	34-36	3
β-strand	41-46	6	1
β-strand	51-56	6	1
α-helix	57-60	4
β-strand	69-71	3	1
α-helix	75	1
β-strand	76-82	7	1
α-helix	84-86	3
β-strand	93	1	2
α-helix	95-97	3
α-helix	98-102	5
α-helix	103-107	5
β-strand	112-116	5	1
β-strand	121-126	6	1
α-helix	127-129	3
α-helix	130-137	8
β-strand	142-147	6	1
β-strand	150-153	4	1
β-strand	177-178	2	1
β-strand	183-187	5	1
β-strand	188	1	3
α-helix	191-193	3
α-helix	194-206	13
β-strand	228-233	6	1
β-strand	236-242	7	1
α-helix	243-246	4
β-strand	254	1	3
β-strand	263-268	6	1
α-helix	280-290	11
β-strand	295	1	2
β-strand	296-299	4	1
β-strand	304-309	6	1
α-helix	310-312	3
α-helix	313-321	9

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
GATS-like protein 3	A, C	protein	349	Homo sapiens	Q8WTX7 (AlphaFold model)

Sequence of entity 1 (A, C), FASTA

>5GV2_1 GATS-like protein 3 (chains A, C)
MGSHHHHHHSSGLVPRGSHMELHILEHRVRVLSVARPGLWLYTHPLIKLLFLPRRSRCKF
FSLTETPEDYTLMVDEEGFKELPPSEFLQVAEATWLVLNVSSHSGAAVQAAGVTKIARSV
IAPLAEHHVSVLMLSTYQTDFILVREQDLSVVIHTLAQEFDIYREVGGEPVPVTRDDSSN
GFPRTQHGPSPTVHPIQSPQNRFCVLTLDPETLPAIATTLIDVLFYSHSTPKEAASSSPE
PSSITFFAFSLIEGYISIVMDAETQKKFPSDLLLTSSSGELWRMVRIGGQPLGFDECGIV
AQIAGPLAAADISAYYISTFNFDHALVPEDGIGSVIEVLQRRQEGLASR

Ligands and cofactors

ID	Name	Formula	Copies
ARG	Arginine	C6 H15 N4 O2	1
MG	Magnesium ion	Mg	1

Primary citation

Structural mechanism for the arginine sensing and regulation of CASTOR1 in the mTORC1 signaling pathway. Gai, Z., Wang, Q., Yang, C. et al. Cell Discov (2016) 2:16051-16051. DOI 10.1038/celldisc.2016.51 · PubMed

Other PDB entries of the same protein (UniProt Q8WTX7 (AlphaFold model), which also has an AlphaFold model), best resolution first:

9PDO 1.8 Å, Arginine-bound CASTOR1 from Homo sapiens (GATOR2-inspired update)
5I2C 1.8 Å, Arginine-bound CASTOR1 from Homo sapiens
5GT7 2.05 Å, Crystal Structure of Arg-bound CASTOR1
5GS9 2.5 Å, Crystal structure of CASTOR1-arginine
5GT8 2.8 Å, Crystal Structure of apo-CASTOR1
9KP4 3.08 Å, Crystal structure of human CASTOR1 in apo form
9DX2 3.4 Å, Human GATOR2 complex - CASTOR1 bound state
9LWF 3.41 Å, Cryo-EM structure of dual sensor bound GATOR2 complex
9OTI 3.5 Å, GATOR2 complex bound to arginine sensor CASTOR1
9LVK 3.59 Å, Cryo-EM structure of CASTOR1 bound human GATOR2 complex

Browse structure collections

About this viewer

MolViewer shows 5GV2 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.