5I2C: Arginine-bound CASTOR1 from Homo sapiens

Arginine-bound CASTOR1 from Homo sapiens. Determined by X-ray diffraction at 1.8 Å resolution. Released 10 Aug 2016.

Method: X-ray diffraction
Resolution: 1.8 Å
Organism: Homo sapiens
Chains: 4
Atoms: 9,872
Mol. weight: 146.17 kDa
Ligands: ARG
Released: 10 Aug 2016

Explore 5I2C in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

5I2C contains 71 α-helices and 77 β-strands across 4 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 19 helices, 20 β-strands

Element	Residues	Length	Sheet
β-strand	2-16	15	1
α-helix	17-19	3
α-helix	20-32	13
α-helix	34-36	3
β-strand	41-46	6	1
β-strand	50-56	7	1
α-helix	57-60	4
β-strand	69-71	3	1
β-strand	76-81	6	1
β-strand	93	1	2
α-helix	94-97	4
α-helix	98-102	5
α-helix	103-107	5
β-strand	112-116	5	1
β-strand	121-126	6	1
α-helix	127-129	3
α-helix	130-137	8
β-strand	142-147	6	1
β-strand	150-153	4	1
α-helix	169-172	4
α-helix	174-176	3
β-strand	177-178	2	1
β-strand	184-187	4	1
β-strand	188	1	3
α-helix	191-193	3
α-helix	195-197	3
α-helix	198-206	9
α-helix	211-213	3
β-strand	228-233	6	1
β-strand	236-242	7	1
α-helix	243-248	6
β-strand	255	1	3
β-strand	263-268	6	1
α-helix	280-290	11
β-strand	295	1	2
β-strand	296-299	4	1
β-strand	304-309	6	1
α-helix	310-312	3
α-helix	313-320	8

Chain B: 17 helices, 19 β-strands

Element	Residues	Length	Sheet
β-strand	2-15	14	4
α-helix	17-23	7
α-helix	24-32	9
α-helix	34-36	3
β-strand	41-46	6	4
β-strand	51-56	6	4
α-helix	57-60	4
β-strand	69-71	3	4
α-helix	75	1
β-strand	76-81	6	4
β-strand	93	1	5
α-helix	94-97	4
α-helix	98-102	5
α-helix	103-107	5
β-strand	112-116	5	4
β-strand	121-126	6	4
α-helix	127-129	3
α-helix	130-137	8
β-strand	142-147	6	4
β-strand	150-153	4	4
α-helix	174-176	3
β-strand	177-178	2	4
β-strand	183-189	7	4
α-helix	191-197	7
α-helix	198-206	9
β-strand	228-233	6	4
β-strand	236-242	7	4
α-helix	243-246	4
β-strand	255	1	4
β-strand	263-268	6	4
α-helix	280-291	12
β-strand	295	1	5
β-strand	296-299	4	4
β-strand	304-309	6	4
α-helix	310-312	3
α-helix	313-320	8

Chain C: 19 helices, 20 β-strands

Element	Residues	Length	Sheet
β-strand	3-15	13	6
α-helix	17-23	7
α-helix	24-32	9
α-helix	34-36	3
β-strand	41-46	6	6
β-strand	51-56	6	6
α-helix	57-60	4
β-strand	69-71	3	6
β-strand	76-81	6	6
β-strand	93	1	7
α-helix	95-97	3
α-helix	98-102	5
α-helix	103-107	5
β-strand	112-116	5	6
β-strand	121-126	6	6
α-helix	127-129	3
α-helix	130-137	8
β-strand	143-147	5	6
β-strand	150-153	4	6
α-helix	167-168	2
α-helix	170-172	3
α-helix	174-176	3
β-strand	177-178	2	6
β-strand	184-187	4	6
β-strand	188	1	8
α-helix	191-193	3
α-helix	194-207	14
β-strand	228-233	6	6
β-strand	236-242	7	6
α-helix	243-246	4
α-helix	250	1
β-strand	255	1	8
β-strand	263-268	6	6
α-helix	280-290	11
β-strand	295	1	7
β-strand	296-299	4	6
β-strand	304-309	6	6
α-helix	310-312	3
α-helix	313-321	9

Chain D: 16 helices, 18 β-strands

Element	Residues	Length	Sheet
β-strand	3-15	13	9
α-helix	17-23	7
α-helix	24-32	9
α-helix	34-36	3
β-strand	41-46	6	9
β-strand	51-56	6	9
α-helix	57-60	4
β-strand	69-71	3	9
β-strand	76-80	5	9
α-helix	95-97	3
α-helix	98-102	5
α-helix	103-107	5
β-strand	112-116	5	9
β-strand	121-126	6	9
α-helix	127-129	3
α-helix	130-137	8
β-strand	143-147	5	9
β-strand	150-153	4	9
β-strand	177-178	2	9
β-strand	183-187	5	9
β-strand	188	1	10
α-helix	191-197	7
α-helix	198-206	9
β-strand	228-233	6	9
β-strand	236-242	7	9
α-helix	243-246	4
α-helix	250	1
β-strand	255	1	10
β-strand	263-268	6	9
α-helix	280-290	11
β-strand	296-299	4	9
β-strand	304-309	6	9
α-helix	310-312	3
α-helix	313-321	9

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
GATS-like protein 3	A, B, C, D	protein	329	Homo sapiens	Q8WTX7 (AlphaFold model)

Sequence of entity 1 (A, B, C, D), FASTA

>5I2C_1 GATS-like protein 3 (chains A, B, C, D)
MELHILEHRVRVLSVARPGLWLYTHPLIKLLFLPRRSRCKFFSLTETPEDYTLMVDEEGF
KELPPSEFLQVAEATWLVLNVSSHSGAAVQAAGVTKIARSVIAPLAEHHVSVLMLSTYQT
DFILVREQDLSVVIHTLAQEFDIYREVGGEPVPVTRDDSSNGFPRTQHGPSPTVHPIQSP
QNRFCVLTLDPETLPAIATTLIDVLFYSHSTPKEAASSSPEPSSITFFAFSLIEGYISIV
MDAETQKKFPSDLLLTSSSGELWRMVRIGGQPLGFDECGIVAQIAGPLAAADISAYYIST
FNFDHALVPEDGIGSVIEVLQRRQEGLAS

Ligands and cofactors

ID	Name	Formula	Copies
ARG	Arginine	C6 H15 N4 O2	4

Water and common crystallization additives (ACT) are not listed.

Primary citation

Mechanism of arginine sensing by CASTOR1 upstream of mTORC1. Saxton, R.A., Chantranupong, L., Knockenhauer, K.E. et al. Nature (2016) 536:229-233. DOI 10.1038/nature19079 · PubMed

Other PDB entries of the same protein (UniProt Q8WTX7 (AlphaFold model), which also has an AlphaFold model), best resolution first:

9PDO 1.8 Å, Arginine-bound CASTOR1 from Homo sapiens (GATOR2-inspired update)
5GT7 2.05 Å, Crystal Structure of Arg-bound CASTOR1
5GV2 2.06 Å, Crystal structure of Arginine-bound CASTOR1 from Homo sapiens
5GS9 2.5 Å, Crystal structure of CASTOR1-arginine
5GT8 2.8 Å, Crystal Structure of apo-CASTOR1
9KP4 3.08 Å, Crystal structure of human CASTOR1 in apo form
9DX2 3.4 Å, Human GATOR2 complex - CASTOR1 bound state
9LWF 3.41 Å, Cryo-EM structure of dual sensor bound GATOR2 complex
9OTI 3.5 Å, GATOR2 complex bound to arginine sensor CASTOR1
9LVK 3.59 Å, Cryo-EM structure of CASTOR1 bound human GATOR2 complex

Browse structure collections

About this viewer

MolViewer shows 5I2C directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.