5HDY: Disks large homolog 4

The third PDZ domain from the synaptic protein PSD-95. Determined by X-ray diffraction at 1.8 Å resolution. Released 11 Jan 2017.

Method: X-ray diffraction
Resolution: 1.8 Å
Organism: Rattus norvegicus
Chains: 1
Atoms: 1,223
Mol. weight: 12.83 kDa
Released: 11 Jan 2017

Explore 5HDY in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

5HDY contains 5 α-helices and 8 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 5 helices, 8 β-strands

Element	Residues	Length	Sheet
α-helix	302-304	3
α-helix	306-308	3
β-strand	312-317	6	1
β-strand	325-329	5	1
β-strand	336-341	6	1
α-helix	346-350	5
β-strand	357-362	6	1
β-strand	365-366	2	1
α-helix	372-381	10
β-strand	385-392	8	1
α-helix	394-398	5
β-strand	404-406	3	2
β-strand	412-414	3	2

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Disks large homolog 4	A	protein	119	Rattus norvegicus	P31016 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>5HDY_1 Disks large homolog 4 (chains A)
GSPEFLGEEDIPREPRRIVIHRGSTGLGFNIVGGEDGEGIFISFILAGGPADLSGELRKG
DQILSVNGVDLRNASHEQAAIALKNAGQTVTIIAQYKPEEYSRFEANSRVDSSGRIVTD

Primary citation

The third PDZ domain from the synaptic protein PSD-95. White, K.I., Raman, A.S., Ranganathan, R. To be published.

Other PDB entries of the same protein (UniProt P31016 (AlphaFold model), which also has an AlphaFold model), best resolution first:

5HEY 1.5 Å, The third PDZ domain from the synaptic protein PSD-95 (G330T mutant) in complex with a…
5MZ7 1.53 Å, Crystal Structure of the third PDZ domain from the synaptic protein PSD-95 with…
1TP5 1.54 Å, Crystal structure of PDZ3 domain of PSD-95 protein complexed with a peptide ligand KKETWV
5HFD 1.6 Å, The third PDZ domain from the synaptic protein PSD-95 (G330T, H372A double mutant)
5HFB 1.62 Å, The third PDZ domain from the synaptic protein PSD-95 (H372A mutant) in complex with a…
5HEB 1.65 Å, The third PDZ domain from the synaptic protein PSD-95 in complex with a C-terminal…
5HED 1.7 Å, The third PDZ domain from the synaptic protein PSD-95 in complex with a mutant…
5HF1 1.75 Å, The third PDZ domain from the synaptic protein PSD-95 (G330T mutant) in complex with a…
5HFF 1.75 Å, The third PDZ domain from the synaptic protein PSD-95 (G330T, H372A double mutant) in…
5HF4 1.75 Å, The third PDZ domain from the synaptic protein PSD-95 (H372A mutant)
1KJW 1.8 Å, SH3-Guanylate Kinase Module from PSD-95
5HFE 1.8 Å, The third PDZ domain from the synaptic protein PSD-95 (G330T, H372A double mutant) in…

Browse structure collections

About this viewer

MolViewer shows 5HDY directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.