The third PDZ domain from the synaptic protein PSD-95 (G330T, H372A double mutant). Determined by X-ray diffraction at 1.6 Å resolution. Released 11 Jan 2017.
Explore 5HFD in 3D Show helices and sheets RCSB PDB PDBe
5HFD contains 5 α-helices and 8 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 302-304 | 3 | |
| α-helix | 306-308 | 3 | |
| β-strand | 312-317 | 6 | 1 |
| β-strand | 325-328 | 4 | 1 |
| β-strand | 337-341 | 5 | 1 |
| α-helix | 346-350 | 5 | |
| β-strand | 357-362 | 6 | 1 |
| β-strand | 365-366 | 2 | 1 |
| α-helix | 372-380 | 9 | |
| β-strand | 385-392 | 8 | 1 |
| α-helix | 394-398 | 5 | |
| β-strand | 404-406 | 3 | 2 |
| β-strand | 412-414 | 3 | 2 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Disks large homolog 4 | A | protein | 119 | Rattus norvegicus | P31016 (AlphaFold model) |
>5HFD_1 Disks large homolog 4 (chains A) GSPEFLGEEDIPREPRRIVIHRGSTGLGFNIVGTEDGEGIFISFILAGGPADLSGELRKG DQILSVNGVDLRNASAEQAAIALKNAGQTVTIIAQYKPEEYSRFEANSRVDSSGRIVTD
The third PDZ domain from the synaptic protein PSD-95 (G330T, H372A double mutant). White, K.I., Raman, A.S., Ranganathan, R. To be published.
Other PDB entries of the same protein (UniProt P31016 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 5HFD directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.