Identification of LXRbeta selective agonists for the treatment of Alzheimer's Disease. Determined by X-ray diffraction at 2.6 Å resolution. Released 6 Apr 2016.
Explore 5HJP in 3D Show helices and sheets RCSB PDB PDBe
5HJP contains 56 α-helices and 10 β-strands across 4 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 301-309 | 9 | |
| α-helix | 337-356 | 20 | |
| α-helix | 365-387 | 23 | |
| α-helix | 388-390 | 3 | |
| β-strand | 394-396 | 3 | 1 |
| β-strand | 402-404 | 3 | 1 |
| α-helix | 405-410 | 6 | |
| α-helix | 414-420 | 7 | |
| α-helix | 421-425 | 5 | |
| α-helix | 426-430 | 5 | |
| α-helix | 435-446 | 12 | |
| α-helix | 457-478 | 22 | |
| α-helix | 485-490 | 6 | |
| α-helix | 492-513 | 22 | |
| α-helix | 517-519 | 3 | |
| α-helix | 520-526 | 7 | |
| α-helix | 542-546 | 5 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 222-244 | 23 | |
| α-helix | 246-248 | 3 | |
| α-helix | 250-252 | 3 | |
| α-helix | 262-288 | 27 | |
| α-helix | 292-294 | 3 | |
| α-helix | 297-317 | 21 | |
| β-strand | 320-321 | 2 | 2 |
| β-strand | 326-329 | 4 | 2 |
| β-strand | 333-335 | 3 | 2 |
| α-helix | 337-342 | 6 | |
| α-helix | 347-363 | 17 | |
| α-helix | 367-378 | 12 | |
| α-helix | 389-410 | 22 | |
| α-helix | 417-444 | 28 | |
| α-helix | 451-457 | 7 | |
| α-helix | 463-465 | 3 | |
| α-helix | 470-476 | 7 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 301-310 | 10 | |
| α-helix | 337-356 | 20 | |
| α-helix | 365-387 | 23 | |
| β-strand | 394-396 | 3 | 3 |
| β-strand | 402-404 | 3 | 3 |
| α-helix | 405-410 | 6 | |
| α-helix | 414-420 | 7 | |
| α-helix | 421-425 | 5 | |
| α-helix | 426-430 | 5 | |
| α-helix | 435-446 | 12 | |
| α-helix | 457-478 | 22 | |
| α-helix | 485-490 | 6 | |
| α-helix | 493-513 | 21 | |
| α-helix | 520-527 | 8 | |
| α-helix | 542-547 | 6 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 222-243 | 22 | |
| α-helix | 250-252 | 3 | |
| α-helix | 263-287 | 25 | |
| α-helix | 292-294 | 3 | |
| α-helix | 297-317 | 21 | |
| β-strand | 320-321 | 2 | 4 |
| β-strand | 326-329 | 4 | 4 |
| β-strand | 333-335 | 3 | 4 |
| α-helix | 337-342 | 6 | |
| α-helix | 347-363 | 17 | |
| α-helix | 367-378 | 12 | |
| α-helix | 389-410 | 22 | |
| α-helix | 417-444 | 28 | |
| α-helix | 447-450 | 4 | |
| α-helix | 451-457 | 7 | |
| α-helix | 463-465 | 3 | |
| α-helix | 470-475 | 6 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Retinoic acid receptor RXR-beta | A, C | protein | 254 | Homo sapiens | P28702 (AlphaFold model) |
| Oxysterols receptor LXR-beta | B, D | protein | 264 | Homo sapiens | P55055 (AlphaFold model) |
>5HJP_1 Retinoic acid receptor RXR-beta (chains A, C) MPVDRILEAELAVEQKSDQGVEGPGGTGGSGSSPNDPVTNICQAADKQLFTLVEWAKRIP HFSSLPLDDQVILLRAGWNELLIASFSHRSIDVRDGILLATGLHVHRNSAHSAGVGAIFD RVLTELVSKMRDMRMDKTELGCLRAIILFNPDAKGLSNPSEVEVLREKVYASLETYCKQK YPEQQGRFAKLLLRLPALRSIGLKCLEHLFFFKLIGDTPIDTFLMEMLEAPHQLAGSGSG SHKILHRLLQDSSS
>5HJP_2 Oxysterols receptor LXR-beta (chains B, D) GVQLTAAQELMIQQLVAAQLQCNKRSFSDQPKVTPWPLGADPASGSASQQRFAHFTELAI ISVQEIVDFAKQVPGFLQLGREDQIALLKASTIEIMLLETARRYNHETECITFLKDFTYS KDDFHRAGLQVEFINPIFEFSRAMRRLGLDDAEYALLIAINIFSADRPNVQEPGRVEALQ QPYVEALLSYTRIKRPQDQLRFPRMLMKLVSLRTLSSVHSEQVFALRLQDKKLPPLLSEI WDVHEGSGSGSHKILHRLLQDSSS
| ID | Name | Formula | Copies |
|---|---|---|---|
| 668 | 2-chloro-4-{1'-[(2R)-2-hydroxy-3-methyl-2-(trifluoromethyl)butanoyl]-4,4'-bipip… | C25 H35 Cl F3 N3 O3 | 2 |
Water and common crystallization additives (PEG) are not listed.
Identification and in Vivo Evaluation of Liver X Receptor beta-Selective Agonists for the Potential Treatment of Alzheimer's Disease. Stachel, S.J., Zerbinatti, C., Rudd, M.T. et al. J Med Chem (2016) 59:3489-3498. DOI 10.1021/acs.jmedchem.6b00176 · PubMed
Other PDB entries of the same protein (UniProt P28702 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 5HJP directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.