5HKW: Apo c-Cbl TKBD Refined to 2.25 A Resolution

Crystal Structure of Apo c-Cbl TKBD Refined to 2.25 A Resolution. Determined by X-ray diffraction at 2.25 Å resolution. Released 18 Jan 2017.

Method: X-ray diffraction
Resolution: 2.25 Å
Organism: Homo sapiens
Chains: 3
Atoms: 7,511
Mol. weight: 107.18 kDa
Released: 18 Jan 2017

Explore 5HKW in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

5HKW contains 60 α-helices and 21 β-strands across 3 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 21 helices, 7 β-strands

Element	Residues	Length	Sheet
α-helix	49-51	3
α-helix	53-71	19
α-helix	73-75	3
α-helix	80	1
α-helix	84-101	18
α-helix	106-111	6
α-helix	113-136	24
α-helix	137-141	5
α-helix	146-168	23
α-helix	170-172	3
α-helix	176-178	3
α-helix	179-181	3
α-helix	184-194	11
β-strand	199-201	3	1
α-helix	202-212	11
α-helix	218-228	11
β-strand	235-237	3	1
α-helix	238-247	10
α-helix	251-253	3
α-helix	254-258	5
α-helix	259-263	5
β-strand	268-271	4	2
α-helix	274-282	9
β-strand	290-295	6	2
β-strand	303-308	6	2
β-strand	314-317	4	2
α-helix	324-333	10
β-strand	339-340	2	2

Chain B: 18 helices, 7 β-strands

Element	Residues	Length	Sheet
α-helix	53-70	18
α-helix	73-75	3
α-helix	84-101	18
α-helix	106-111	6
α-helix	113-136	24
α-helix	137-141	5
α-helix	146-168	23
α-helix	170-172	3
α-helix	176-178	3
α-helix	184-194	11
β-strand	199-201	3	3
α-helix	202-210	9
α-helix	218-228	11
β-strand	235-237	3	3
α-helix	238-248	11
α-helix	251-253	3
α-helix	254-258	5
α-helix	259-263	5
β-strand	268-271	4	4
α-helix	274-282	9
β-strand	290-295	6	4
β-strand	303-308	6	4
β-strand	314-317	4	4
α-helix	324-333	10
β-strand	339-340	2	4

Chain C: 21 helices, 7 β-strands

Element	Residues	Length	Sheet
α-helix	49-51	3
α-helix	53-71	19
α-helix	73-75	3
α-helix	80	1
α-helix	84-101	18
α-helix	106-111	6
α-helix	113-136	24
α-helix	137-140	4
α-helix	146-168	23
α-helix	170-172	3
α-helix	176-178	3
α-helix	184-194	11
β-strand	199-201	3	5
α-helix	202-212	11
α-helix	218-228	11
β-strand	235-237	3	5
α-helix	238-247	10
α-helix	251-253	3
α-helix	254-258	5
α-helix	259-263	5
β-strand	268-271	4	6
α-helix	274-280	7
α-helix	281-284	4
β-strand	290-296	7	6
β-strand	299-308	10	6
β-strand	314-317	4	6
α-helix	324-332	9
β-strand	339-340	2	6

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
E3 ubiquitin-protein ligase CBL	A, B, C	protein	308	Homo sapiens	P22681 (AlphaFold model)

Sequence of entity 1 (A, B, C), FASTA

>5HKW_1 E3 ubiquitin-protein ligase CBL (chains A, B, C)
SNAPPGTVDKKMVEKCWKLMDKVVRLCQNPKLALKNSPPYILDLLPDTYQHLRTILSRYE
GKMETLGENEYFRVFMENLMKKTKQTISLFKEGKERMYEENSQPRRNLTKLSLIFSHMLA
ELKGIFPSGLFQGDTFRITKADAAEFWRKAFGEKTIVPWKSFRQALHEVHPISSGLEAMA
LKSTIDLTCNDYISVFEFDIFTRLFQPWSSLLRNWNSLAVTHPGYMAFLTYDEVKARLQK
FIHKPGSYIFRLSCTRLGQWAIGYVTADGNILQTIPHNKPLFQALIDGFREGFYLFPDGR
NQNPDLTG

Primary citation

Crystal Structure of Apo c-Cbl TKBD Refined to 2.25 A Resolution. Zhang, N., Ferris, D., Lovell, S. et al. To be published.

Other PDB entries of the same protein (UniProt P22681 (AlphaFold model), which also has an AlphaFold model), best resolution first:

3BUX 1.35 Å, Crystal structure of c-Cbl-TKB domain complexed with its binding motif in c-Met
3BUW 1.45 Å, Crystal structure of c-Cbl-TKB domain complexed with its binding motif in Syk
7SIY 1.48 Å, cCBL TKB domain in complex with pZAP70 peptide
5HKY 1.8 Å, Crystal structure of c-Cbl TKBD domain in complex with SPRY2 peptide (36-60, pY55)…
5HKZ 1.8 Å, Crystal Structure of c-Cbl TKBD in complex with SPRY2 peptide (36-60, pY55) Refined to…
5HKX 1.85 Å, Crystal Structure of c-Cbl TKBD-RING domains (Y371E mutant) Refined to 1.85 A Resolution
3PLF 1.92 Å, Reverse Binding Mode of MetRD peptide complexed with c-Cbl TKB domain
2Y1N 2.0 Å, Structure of c-Cbl-ZAP-70 peptide complex
3BUM 2.0 Å, Crystal structure of c-Cbl-TKB domain complexed with its binding motif in Sprouty2
3BUN 2.0 Å, Crystal structure of c-Cbl-TKB domain complexed with its binding motif in Sprouty4
9ERZ 2.02 Å, Structure of CBL-TKBD bound to Ubiquitin-fused CBLock peptide
1YVH 2.05 Å, Crystal Structure of the c-Cbl TKB Domain in Complex with the APS pTyr-618 Phosphopeptide

Browse structure collections

About this viewer

MolViewer shows 5HKW directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.