5HPS: WWP1 hect

Name: PDB 5HPS: System-wide modulation of HECT E3 ligases with selective ubiquitin variant probes: WWP1 and UbV P1.1
Published: 2016-03-16
License: https://creativecommons.org/publicdomain/zero/1.0/
Keywords: ligase

System-wide modulation of HECT E3 ligases with selective ubiquitin variant probes: WWP1 and UbV P1.1. Determined by X-ray diffraction at 2.05 Å resolution. Released 16 Mar 2016.

Method: X-ray diffraction
Resolution: 2.05 Å
Organism: Homo sapiens
Chains: 2
Atoms: 3,817
Mol. weight: 54.65 kDa
Released: 16 Mar 2016

Explore 5HPS in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

5HPS contains 27 α-helices and 23 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 24 helices, 15 β-strands

Element	Residues	Length	Sheet
α-helix	547-559	13
β-strand	566-571	6	1
α-helix	576-586	11
α-helix	589-593	5
β-strand	595-600	6	1
α-helix	611-623	13
α-helix	626-628	3
β-strand	631-633	3	2
β-strand	641-643	3	2
α-helix	645-649	5
α-helix	653-669	17
α-helix	680-686	7
α-helix	689-691	3
α-helix	693-699	7
α-helix	701-712	12
α-helix	715-718	4
β-strand	720	1	3
β-strand	723	1	4
β-strand	725-730	6	5
β-strand	733-738	6	5
β-strand	746	1	4
α-helix	752-765	14
α-helix	770-783	14
α-helix	786-791	6
α-helix	794-802	9
α-helix	809-814	6
β-strand	817-819	3	6
α-helix	826-837	12
α-helix	840-851	12
α-helix	855-857	3
α-helix	860-863	4
β-strand	865-867	3	7
β-strand	869-870	2	7
β-strand	874-876	3	6
α-helix	884-885	2
β-strand	886-888	3	6
α-helix	889-891	3
β-strand	893-895	3	6
α-helix	902-914	13

Chain B: 3 helices, 8 β-strands

Element	Residues	Length	Sheet
β-strand	2-6	5	8
β-strand	12-16	5	8
β-strand	22	1	9
α-helix	23-34	12
α-helix	38-40	3
β-strand	41-45	5	8
β-strand	48-49	2	8
α-helix	50-51	2
β-strand	55	1	9
β-strand	65-71	7	8
β-strand	72	1	3

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
WWP1 hect	A	protein	383	Homo sapiens	Q9H0M0 (AlphaFold model)
Ubiquitin variant P1.1	B	protein	83	Homo sapiens	P62987 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>5HPS_1 WWP1 HECT (chains A)
GSGGPQIAYERGFRWKLAHFRYLCQSNALPSHVKINVSRQTLFEDSFQQIMALKPYDLRR
RLYVIFRGEEGLDYGGLAREWFFLLSHEVLNPMYCLFEYAGKNNYCLQINPASTINPDHL
SYFCFIGRFIAMALFHGKFIDTGFSLPFYKRMLSKKLTIKDLESIDTEFYNSLIWIRDNN
IEECGLEMYFSVDMEILGKVTSHDLKLGGSNILVTEENKDEYIGLMTEWRFSRGVQEQTK
AFLDGFNEVVPLQWLQYFDEKELEVMLCGMQEVDLADWQRNTVYRHYTRNSKQIIWFWQF
VKETDNEVRMRLLQFVTGTCRLPLGGFAELMGSNGPQKFCIEKVGKDTWLPRSHTCFNRL
DLPPYKSYEQLKEKLLFAIEETE

Sequence of entity 2 (B), FASTA

>5HPS_2 Ubiquitin variant P1.1 (chains B)
GSGGSMHIFVKTLRGWSITLEVEPSDTIENVKAKIQDKEGIPPDQQILIFARKKLEDGRT
LSDYNIQEKSSLYLFLRLLRKSR

Primary citation

System-Wide Modulation of HECT E3 Ligases with Selective Ubiquitin Variant Probes. Zhang, W., Wu, K.P., Sartori, M.A. et al. Mol Cell (2016) 62:121-136. DOI 10.1016/j.molcel.2016.02.005 · PubMed

Other PDB entries of the same protein (UniProt Q9H0M0 (AlphaFold model), which also has an AlphaFold model), best resolution first:

1ND7 2.1 Å, Conformational Flexibility Underlies Ubiquitin Ligation Mediated by the WWP1 HECT domain…
6J1X 2.3 Å, WWP1 close conformation
8EI4 2.43 Å, Crystal structure of the WWP1 HECT domain in complex with H302, a Helicon Polypeptide
6J1Y 2.55 Å, Semi-open conformation E3 ligase
5HPT 2.84 Å, System-wide modulation of HECT E3 ligases with selective ubiquitin variant probes: WWP1,…
9EQK 3.0 Å, WWP1 WW2-2,3-linker-WW3-WW4-HECT (WWP1-2L34H) with ordered WW2 domain
2OP7 WW4

Browse structure collections

About this viewer

MolViewer shows 5HPS directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.