Crystal structure of thioredoxin E101G mutant. Determined by X-ray diffraction at 1.31 Å resolution. Released 22 Feb 2017.
Explore 5HR0 in 3D Show helices and sheets RCSB PDB PDBe
5HR0 contains 12 α-helices and 10 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 4-6 | 3 | 1 |
| α-helix | 7 | 1 | |
| α-helix | 12 | 1 | |
| α-helix | 13-17 | 5 | |
| β-strand | 22-28 | 7 | 1 |
| α-helix | 33-48 | 16 | |
| β-strand | 54-59 | 6 | 1 |
| α-helix | 67-70 | 4 | |
| β-strand | 77-82 | 6 | 1 |
| β-strand | 85-91 | 7 | 1 |
| α-helix | 96-106 | 11 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 4-6 | 3 | 2 |
| α-helix | 7 | 1 | |
| α-helix | 12 | 1 | |
| α-helix | 13-17 | 5 | |
| β-strand | 22-28 | 7 | 2 |
| α-helix | 33-48 | 16 | |
| β-strand | 53-59 | 7 | 2 |
| α-helix | 67-70 | 4 | |
| β-strand | 77-82 | 6 | 2 |
| β-strand | 85-91 | 7 | 2 |
| α-helix | 96-106 | 11 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Thioredoxin | A, B | protein | 109 | Escherichia coli | P0AA25 (AlphaFold model) |
>5HR0_1 Thioredoxin (chains A, B) MSDKIIHLTDDSFDTDVLKADGAILVDFWAEWCGPCKMIAPILDEIADEYQGKLTVAKLN IDQNPGTAPKYGIRGIPTLLLFKNGEVAATKVGALSKGQLKGFLDANLA
| ID | Name | Formula | Copies |
|---|---|---|---|
| CU | Copper (II) ion | Cu | 4 |
Structural variability of E. coli thioredoxin captured in the crystal structures of single-point mutants. Noguera, M.E., Vazquez, D.S., Ferrer-Sueta, G. et al. Sci Rep (2017) 7:42343-42343. DOI 10.1038/srep42343 · PubMed
Other PDB entries of the same protein (UniProt P0AA25 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 5HR0 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.