5HR1: Thioredoxin L107A mutant

Crystal structure of thioredoxin L107A mutant. Determined by X-ray diffraction at 2.14 Å resolution. Released 22 Feb 2017.

Method: X-ray diffraction
Resolution: 2.14 Å
Organism: Escherichia coli O157:H7
Chains: 7
Atoms: 5,541
Mol. weight: 82.56 kDa
Ligands: CU
Released: 22 Feb 2017

Explore 5HR1 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

5HR1 contains 33 α-helices and 32 β-strands across 7 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 5 helices, 5 β-strands

Element	Residues	Length	Sheet
β-strand	5-6	2	1
α-helix	9-12	4
α-helix	13-17	5
β-strand	22-28	7	1
α-helix	33-48	16
β-strand	54-59	6	1
α-helix	66-69	4
β-strand	77-82	6	1
β-strand	85-91	7	1
α-helix	96-105	10

Chains B, C and F: 5 helices, 5 β-strands

Element	Residues	Length	Sheet
β-strand	5-6	2	1
α-helix	12	1
α-helix	13-17	5
β-strand	22-28	7	1
α-helix	33-48	16
β-strand	53-59	7	1
α-helix	66-69	4
β-strand	77-82	6	1
β-strand	85-91	7	1
α-helix	96-105	10

Chain D: 5 helices, 5 β-strands

Element	Residues	Length	Sheet
β-strand	5-7	3	3
α-helix	12	1
α-helix	13-17	5
β-strand	22-28	7	3
α-helix	33-48	16
β-strand	54-59	6	3
α-helix	66-69	4
β-strand	77-82	6	3
β-strand	85-91	7	3
α-helix	96-105	10

Chain E: 5 helices, 5 β-strands

Element	Residues	Length	Sheet
β-strand	5-7	3	4
α-helix	12	1
α-helix	13-17	5
β-strand	22-28	7	4
α-helix	33-48	16
β-strand	53-59	7	4
α-helix	66-69	4
β-strand	77-82	6	4
β-strand	85-91	7	4
α-helix	96-106	11

Chain G: 3 helices, 2 β-strands

Element	Residues	Length	Sheet
α-helix	33-48	16
α-helix	67-70	4
β-strand	77-82	6	6
β-strand	85-91	7	6
α-helix	96-102	7

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Thioredoxin-1	A, B, C, D, E, F, G	protein	109	Escherichia coli O157:H7	P0AA25 (AlphaFold model)

Sequence of entity 1 (A, B, C, D, E, F, G), FASTA

>5HR1_1 Thioredoxin-1 (chains A, B, C, D, E, F, G)
MSDKIIHLTDDSFDTDVLKADGAILVDFWAEWCGPCKMIAPILDEIADEYQGKLTVAKLN
IDQNPGTAPKYGIRGIPTLLLFKNGEVAATKVGALSKGQLKEFLDANAA

Ligands and cofactors

ID	Name	Formula	Copies
CU	Copper (II) ion	Cu	2

Primary citation

Structural variability of E. coli thioredoxin captured in the crystal structures of single-point mutants. Noguera, M.E., Vazquez, D.S., Ferrer-Sueta, G. et al. Sci Rep (2017) 7:42343-42343. DOI 10.1038/srep42343 · PubMed

Other PDB entries of the same protein (UniProt P0AA25 (AlphaFold model), which also has an AlphaFold model), best resolution first:

4HUA 1.1 Å, E. coli thioredoxin variant with (4R)-FluoroPro76 as single proline residue
5HR3 1.1 Å, Crystal structure of thioredoxin N106A mutant
5HR2 1.2 Å, Crystal structure of thioredoxin L94A mutant
5HR0 1.31 Å, Crystal structure of thioredoxin E101G mutant
4HU7 1.4 Å, E. coli thioredoxin variant with Pro76 as single proline residue
4HU9 1.55 Å, E. coli thioredoxin variant with (4S)-FluoroPro76 as single proline residue
4X43 1.65 Å, Structure of proline-free E. coli Thioredoxin
2TRX 1.68 Å, Crystal structure of thioredoxin from escherichia coli at 1.68 Å resolution
6Y4Y 1.75 Å, The crystal structure of human MACROD2 in space group P41212
1KEB 1.8 Å, Crystal Structure of Double Mutant M37L,P40S E.coli Thioredoxin
2EIQ 1.9 Å, Design of Disulfide-linked Thioredoxin Dimers and Multimers Through Analysis of Crystal…
6Y4Z 1.9 Å, The crystal structure of human MACROD2 in space group P43212

Browse structure collections

About this viewer

MolViewer shows 5HR1 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.