Endonuclease inhibitor 2 bound to influenza strain H1N1 polymerase acidic subunit N-terminal region at pH 7.0. Determined by X-ray diffraction at 2.15 Å resolution. Released 17 Feb 2016.
Explore 5I13 in 3D Show helices and sheets RCSB PDB PDBe
5I13 contains 9 α-helices and 5 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 1-8 | 8 | |
| α-helix | 11-23 | 13 | |
| α-helix | 32-50 | 19 | |
| β-strand | 76-78 | 3 | 1 |
| α-helix | 84-98 | 15 | |
| α-helix | 100-103 | 4 | |
| β-strand | 109-111 | 3 | 1 |
| β-strand | 116-123 | 8 | 1 |
| α-helix | 127-138 | 12 | |
| β-strand | 144-149 | 6 | 1 |
| β-strand | 154-156 | 3 | 1 |
| α-helix | 157-159 | 3 | |
| α-helix | 165-184 | 20 | |
| α-helix | 188-193 | 6 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Polymerase acidic protein | A | protein | 191 | Influenza A virus (strain A/Puerto Rico/8/1934 H1N1) | P03433 (AlphaFold model) |
>5I13_1 Polymerase acidic protein (chains A) GPLGSMEDFVRQCFNPMIVELAEKTMKEYGEDLKIETNKFAAICTHLEVCFMYSDASKHR FEIIEGRDRTMAWTVVNSICNTTGAEKPKFLPDLYDYKENRFIEIGVTRREVHIYYLEKA NKIKSEKTHIHIFSFTGEEMATKADYTLDEESRARIKTRLFTIRQEMASRGLWDSFRQSE RGAAELALVPR
| ID | Name | Formula | Copies |
|---|---|---|---|
| 4P9 | 4-{(E)-[2-(4-chlorophenyl)hydrazinylidene]methyl}benzene-1,2,3-triol | C13 H11 Cl N2 O3 | 2 |
| MN | Manganese (II) ion | Mn | 2 |
Water and common crystallization additives (SO4) are not listed.
Two Distinctive Binding Modes of Endonuclease Inhibitors to the N-Terminal Region of Influenza Virus Polymerase Acidic Subunit. Fudo, S., Yamamoto, N., Nukaga, M. et al. Biochemistry (2016) 55:2646-2660. DOI 10.1021/acs.biochem.5b01087 · PubMed
Other PDB entries of the same protein (UniProt P03433 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 5I13 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.