Crystal Structure of Human Nonmuscle Myosin 2C motor domain. Determined by X-ray diffraction at 2.25 Å resolution. Released 13 Sept 2017.
Explore 5I4E in 3D Show helices and sheets RCSB PDB PDBe
5I4E contains 47 α-helices and 30 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 51-53 | 3 | |
| β-strand | 55-60 | 6 | 1 |
| β-strand | 64-73 | 10 | 1 |
| β-strand | 77-82 | 6 | 1 |
| β-strand | 88-92 | 5 | 1 |
| α-helix | 93-95 | 3 | |
| β-strand | 97-98 | 2 | 1 |
| α-helix | 102-104 | 3 | |
| β-strand | 109 | 1 | 2 |
| α-helix | 110-112 | 3 | |
| α-helix | 118-129 | 12 | |
| β-strand | 135-138 | 4 | 2 |
| β-strand | 141-145 | 5 | 2 |
| α-helix | 156-162 | 7 | |
| α-helix | 174-188 | 15 | |
| β-strand | 192-197 | 6 | 2 |
| β-strand | 199 | 1 | 3 |
| α-helix | 204-218 | 15 | |
| α-helix | 233-249 | 17 | |
| β-strand | 250-251 | 2 | 4 |
| β-strand | 259-260 | 2 | 4 |
| β-strand | 263-270 | 8 | 2 |
| β-strand | 276-284 | 9 | 2 |
| α-helix | 288-291 | 4 | |
| β-strand | 301 | 1 | 4 |
| α-helix | 302-310 | 9 | |
| α-helix | 313-318 | 6 | |
| α-helix | 324-326 | 3 | |
| α-helix | 340-354 | 15 | |
| α-helix | 359-374 | 16 | |
| α-helix | 375-377 | 3 | |
| β-strand | 381-382 | 2 | 5 |
| β-strand | 388 | 1 | 6 |
| β-strand | 389-390 | 2 | 5 |
| α-helix | 395-404 | 10 | |
| α-helix | 408-416 | 9 | |
| β-strand | 419-422 | 4 | 7 |
| β-strand | 425-428 | 4 | 7 |
| β-strand | 432 | 1 | 6 |
| α-helix | 433-463 | 31 | |
| β-strand | 473-477 | 5 | 2 |
| α-helix | 479-481 | 3 | |
| β-strand | 482 | 1 | 3 |
| α-helix | 490-507 | 18 | |
| α-helix | 508-512 | 5 | |
| α-helix | 513-519 | 7 | |
| α-helix | 535-542 | 8 | |
| α-helix | 550-558 | 9 | |
| α-helix | 565-576 | 12 | |
| β-strand | 582-583 | 2 | 8 |
| α-helix | 584-586 | 3 | |
| β-strand | 594-598 | 5 | 8 |
| β-strand | 601-605 | 5 | 8 |
| α-helix | 610-615 | 6 | |
| α-helix | 620-627 | 8 | |
| α-helix | 632-637 | 6 | |
| α-helix | 644-646 | 3 | |
| α-helix | 670-686 | 17 | |
| β-strand | 689-696 | 8 | 2 |
| α-helix | 709-719 | 11 | |
| α-helix | 721-730 | 10 | |
| β-strand | 734-737 | 4 | 9 |
| α-helix | 738-745 | 8 | |
| α-helix | 760-771 | 12 | |
| α-helix | 775-777 | 3 | |
| β-strand | 778-780 | 3 | 9 |
| β-strand | 784-787 | 4 | 9 |
| α-helix | 791-826 | 36 | |
| α-helix | 835-851 | 17 | |
| α-helix | 853-873 | 21 | |
| α-helix | 881-883 | 3 | |
| α-helix | 890-941 | 52 | |
| α-helix | 942-946 | 5 | |
| α-helix | 955-964 | 10 | |
| α-helix | 965-968 | 4 | |
| α-helix | 969-987 | 19 | |
| α-helix | 997-1020 | 24 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Myosin-14,Alpha-actinin A | A | protein | 980 | Homo sapiens, Dictyostelium discoideum | P05095 (AlphaFold model), Q7Z406 (AlphaFold model) |
>5I4E_1 Myosin-14,Alpha-actinin A (chains A) QVEWTARRLVWVPSELHGFEAAALRDEGEEEAEVELAESGRRLRLPRDQIQRMNPPKFSK AEDMAELTCLNEASVLHNLRERYYSGLIYTYSGLFCVVINPYKQLPIYTEAIVEMYRGKK RHEVPPHVYAVTEGAYRSMLQDREDQSILCTGESGAGKTENTKKVIQYLAHVASSPKGRK EPGVPGELERQLLQANPILEAFGNAKTVKNDNSSRFGKFIRINFDVAGYIVGANIETYLL EKSRAIRQAKDECSFHIFYQLLGGAGEQLKADLLLEPCSHYRFLTNGPSSSPGQERELFQ ETLESLRVLGFSHEEIISMLRMVSAVLQFGNIALKRERNTDQATMPDNTAAQKLCRLLGL GVTDFSRALLTPRIKVGRDYVQKAQTKEQADFALEALAKATYERLFRWLVLRLNRALDRS PRQGASFLGILDIAGFEIFQLNSFEQLCINYTNEKLQQLFNHTMFVLEQEEYQREGIPWT FLDFGLDLQPCIDLIERPANPPGLLALLDEECWFPKATDKSFVEKVAQEQGGHPKFQRPR HLRDQADFSVLHYAGKVDYKANEWLMKNMDPLNDNVAALLHQSTDRLTAEIWKDVEGIVG LEQVSSLGDGPPGGRPRRGMFRTVGQLYKESLSRLMATLSNTNPSFVRCIVPNHEKRAGK LEPRLVLDQLRCNGVLEGIRICRQGFPNRILFQEFRQRYEILTPNAIPKGFMDGKQACEK MIQALELDPNLYRVGQSKIFFRAGVLAQLEEERASEQTKSDYLKRANELVQWINDKQASL ESRDFGDSIESVQSFMNAHKEYKKTEKPPKGQEVSELEAIYNSLQTKLRLIKREPFVAPA GLTPNEIDSTWSALEKAEQEHAEALRIELKRQKKIAVLLQKYNRILKKLENWATTKSVYL GSNETGDSITAVQAKLKNLEAFDGECQSLEGQSNSDLLSILAQLTELNYNGVPELTERKD TFFAQQWTGVKSSAETYKNT
Mechanistic insights into the active site and allosteric communication pathways in human nonmuscle myosin-2C. Chinthalapudi, K., Heissler, S.M., Preller, M. et al. Elife (2017) 6. DOI 10.7554/eLife.32742 · PubMed
Other PDB entries of the same protein (UniProt P05095 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 5I4E directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.