5IAA: Human UBA5

Crystal structure of human UBA5 in complex with UFM1. Determined by X-ray diffraction at 1.85 Å resolution. Released 28 Sept 2016.

Method: X-ray diffraction
Resolution: 1.85 Å
Organism: Homo sapiens
Chains: 4
Atoms: 5,218
Mol. weight: 82.41 kDa
Ligands: ZN
Released: 28 Sept 2016

Explore 5IAA in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

5IAA contains 28 α-helices and 48 β-strands across 4 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 13 helices, 15 β-strands

Element	Residues	Length	Sheet
α-helix	71-73	3
β-strand	75-79	5	1
α-helix	83-95	13
β-strand	99-103	5	1
α-helix	106	1
β-strand	107	1	2
α-helix	108	1
α-helix	120-122	3
β-strand	126	1	2
α-helix	127-138	12
β-strand	143-147	5	1
α-helix	154-166	13
β-strand	167	1	3
β-strand	173	1	3
β-strand	177-180	4	1
α-helix	185-198	14
β-strand	202-207	6	1
β-strand	213-219	7	1
α-helix	233-236	4
α-helix	254-274	21
β-strand	282-286	5	1
β-strand	291	1	1
β-strand	294-295	2	1
α-helix	297	1
β-strand	298	1	4
α-helix	299	1
α-helix	306-320	15
β-strand	344-345	2	5

Chain B: 11 helices, 15 β-strands

Element	Residues	Length	Sheet
α-helix	71-73	3
β-strand	75-79	5	6
α-helix	83-95	13
β-strand	99-104	6	6
α-helix	127-138	12
β-strand	143-148	6	6
α-helix	154-166	13
β-strand	167	1	7
β-strand	173	1	7
β-strand	177-180	4	6
α-helix	185-198	14
β-strand	202-207	6	6
β-strand	213-219	7	6
β-strand	221	1	8
β-strand	224	1	8
α-helix	227-229	3
α-helix	233-236	4
α-helix	254-274	21
β-strand	282-286	5	6
β-strand	291	1	6
β-strand	294-295	2	6
α-helix	297	1
β-strand	298	1	9
α-helix	299	1
α-helix	306-320	15
β-strand	344-345	2	10

Chains C and D: 2 helices, 9 β-strands

Element	Residues	Length	Sheet
β-strand	5-10	6	10
β-strand	18-22	5	10
β-strand	28	1	11
α-helix	29-39	11
β-strand	47-51	5	10
β-strand	55	1	4
β-strand	56-57	2	10
β-strand	62	1	11
α-helix	63-70	8
β-strand	73-78	6	10
β-strand	82	1	1

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Ubiquitin-like modifier-activating enzyme 5	A, B	protein	290	Homo sapiens	Q9GZZ9 (AlphaFold model)
Ubiquitin-fold modifier 1	C, D	protein	83	Homo sapiens	P61960 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>5IAA_1 Ubiquitin-like modifier-activating enzyme 5 (chains A, B)
MALKRMGIVSDYEKIRTFAVAIVGVGGVGSVTAEMLTRCGIGKLLLFDYDKVELANMNRL
FFQPHQAGLSKVQAAEHTLRNINPDVLFEVHNYNITTVENFQHFMDRISNGGLEEGKPVD
LVLSCVDNFEARMTINTACNELGQTWMESGVSENAVSGHIQLIIPGESACFACAPPLVVA
ANIDEKTLKREGVCAASLPTTMGVVAGILVQNVLKFLLNFGTVSFYLGYNAMQDFFPTMS
MKPNPQCDDRNCRKQQEEYKKKVAALPKQEVIQEEEEIIHEDNEWGIELV

Sequence of entity 2 (C, D), FASTA

>5IAA_2 Ubiquitin-fold modifier 1 (chains C, D)
MSKVSFKITLTSDPRLPYKVLSVPESTPFTAVLKFAAEEFKVPAATSAIITNDGIGINPA
QTAGNVFLKHGSELRIIPRDRVG

Ligands and cofactors

ID	Name	Formula	Copies
ZN	Zinc ion	Zn	2

Primary citation

Trans-Binding Mechanism of Ubiquitin-like Protein Activation Revealed by a UBA5-UFM1 Complex. Oweis, W., Padala, P., Hassouna, F. et al. Cell Rep (2016) 16:3113-3120. DOI 10.1016/j.celrep.2016.08.067 · PubMed

Other PDB entries of the same protein (UniProt Q9GZZ9 (AlphaFold model), which also has an AlphaFold model), best resolution first:

7NW1 1.95 Å, Crystal structure of UFC1 in complex with UBA5
3H8V 2.0 Å, Human Ubiquitin-activating Enzyme 5 in Complex with ATP
5IA8 2.0 Å, Structure of a Ubiquitin like protein with an E1 fragment
5L95 2.1 Å, Crystal structure of human UBA5 in complex with UFM1 and AMP
6H77 2.1 Å, E1 enzyme for ubiquitin like protein activation in complex with UBL
3GUC 2.25 Å, Human Ubiquitin-activating Enzyme 5 in Complex with AMPPNP
5HKH 2.55 Å, Crystal structure of Ufm1 in complex with UBA5
7NVK 2.65 Å, Crystal structure of UBA5 fragment fused to the N-terminus of UFC1
6H78 2.7 Å, E1 enzyme for ubiquitin like protein activation.
6H8C Structure of the human GABARAPL2 protein in complex with the UBA5 LIR motif
7OVC Structure of the human UFC1 protein in complex with the UBA5 C-terminal UFC1-binding…

Browse structure collections

About this viewer

MolViewer shows 5IAA directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.