Structure of UTP6. Determined by X-ray diffraction at 3.3 Å resolution. Released 6 Jul 2016.
Explore 5IC8 in 3D Show helices and sheets RCSB PDB PDBe
5IC8 contains 70 α-helices and 4 β-strands across 4 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 87-102 | 16 | |
| α-helix | 107-119 | 13 | |
| α-helix | 123-136 | 14 | |
| α-helix | 141-153 | 13 | |
| α-helix | 157-170 | 14 | |
| α-helix | 176-195 | 20 | |
| α-helix | 241-243 | 3 | |
| β-strand | 247 | 1 | 1 |
| β-strand | 253 | 1 | 1 |
| α-helix | 256 | 1 | |
| α-helix | 258 | 1 | |
| α-helix | 262-270 | 9 | |
| α-helix | 273-275 | 3 | |
| α-helix | 277-286 | 10 | |
| α-helix | 294-304 | 11 | |
| α-helix | 313-327 | 15 | |
| α-helix | 332-340 | 9 | |
| α-helix | 341-343 | 3 | |
| α-helix | 352-369 | 18 | |
| α-helix | 374-389 | 16 | |
| α-helix | 396-408 | 13 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 87-102 | 16 | |
| α-helix | 107-119 | 13 | |
| α-helix | 123-136 | 14 | |
| α-helix | 141-153 | 13 | |
| α-helix | 157-170 | 14 | |
| α-helix | 176-195 | 20 | |
| α-helix | 241-243 | 3 | |
| β-strand | 247 | 1 | 2 |
| β-strand | 253 | 1 | 2 |
| α-helix | 256 | 1 | |
| α-helix | 258 | 1 | |
| α-helix | 262-270 | 9 | |
| α-helix | 277-286 | 10 | |
| α-helix | 294-305 | 12 | |
| α-helix | 312-327 | 16 | |
| α-helix | 332-340 | 9 | |
| α-helix | 341-343 | 3 | |
| α-helix | 352-369 | 18 | |
| α-helix | 374-389 | 16 | |
| α-helix | 396-408 | 13 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 87-102 | 16 | |
| α-helix | 107-119 | 13 | |
| α-helix | 123-136 | 14 | |
| α-helix | 141-153 | 13 | |
| α-helix | 157-170 | 14 | |
| α-helix | 176-193 | 18 | |
| α-helix | 241-243 | 3 | |
| α-helix | 256-258 | 3 | |
| α-helix | 262-269 | 8 | |
| α-helix | 277-286 | 10 | |
| α-helix | 294-305 | 12 | |
| α-helix | 313-327 | 15 | |
| α-helix | 333-344 | 12 | |
| α-helix | 353-368 | 16 | |
| α-helix | 378-390 | 13 | |
| α-helix | 397-408 | 12 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 87-102 | 16 | |
| α-helix | 107-119 | 13 | |
| α-helix | 123-136 | 14 | |
| α-helix | 141-153 | 13 | |
| α-helix | 157-170 | 14 | |
| α-helix | 176-193 | 18 | |
| α-helix | 241-243 | 3 | |
| α-helix | 256-258 | 3 | |
| α-helix | 262-269 | 8 | |
| α-helix | 277-286 | 10 | |
| α-helix | 294-305 | 12 | |
| α-helix | 312-327 | 16 | |
| α-helix | 332-340 | 9 | |
| α-helix | 354-367 | 14 | |
| α-helix | 371 | 1 | |
| α-helix | 374-390 | 17 | |
| α-helix | 396-408 | 13 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Putative uncharacterized protein | A, B, C, D | protein | 334 | Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719) | G0S387 (AlphaFold model) |
>5IC8_1 Putative uncharacterized protein (chains A, B, C, D) RSVTSHASQARTFGIFERAVLKHPGSIELWLAYLEFAAQVKATKRWRRIMTRALRLHPMN ASLWTLAGRRAAQNGDMQRARAHFLRGCRFCTREPTLWLEYARCEMDWLARMEAKKQGQG VRKGVNALEAIKATEGQEEGDIIPIGEDTEDDSGDEDGLILPDPDAEGTDGTKKAAKPVF DAEQTKKLEQSPALSGAIPIAVFDVARKQPFWGPAAAEKFFDVFAKFGHLSCHERIISHV VTTMQELFPNHPCTWSVHIRQPLVGVDVLTPAFPKALRESLARLKAALQSTTDRKALATK MVAWMDGILAIEKLDAAIRTVLEHTKRSLEESPS
Integrative structural analysis of the UTPB complex, an early assembly factor for eukaryotic small ribosomal subunits. Zhang, C., Sun, Q., Chen, R. et al. Nucleic Acids Res (2016) 44:7475-7486. DOI 10.1093/nar/gkw562 · PubMed
Other PDB entries of the same protein (UniProt G0S387 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 5IC8 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.