5IC9: CTD complex of Utp12 and Utp13

Structure of the CTD complex of Utp12 and Utp13. Determined by X-ray diffraction at 3.7 Å resolution. Released 6 Jul 2016.

Method: X-ray diffraction
Resolution: 3.7 Å
Organism: Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719)
Chains: 4
Atoms: 4,015
Mol. weight: 87.21 kDa
Released: 6 Jul 2016

Explore 5IC9 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

5IC9 contains 25 α-helices and 0 β-strands across 4 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 6 helices, 0 β-strands

Element	Residues	Length
α-helix	773-797	25
α-helix	827-835	9
α-helix	842-847	6
α-helix	853-866	14
α-helix	871-884	14
α-helix	894-929	36

Chain B: 7 helices, 0 β-strands

Element	Residues	Length
α-helix	743-750	8
α-helix	754-763	10
α-helix	768-778	11
α-helix	792-800	9
α-helix	803-818	16
α-helix	823-836	14
α-helix	857-887	31

Chain C: 6 helices, 0 β-strands

Element	Residues	Length
α-helix	775-803	29
α-helix	810-812	3
α-helix	827-835	9
α-helix	854-866	13
α-helix	871-883	13
α-helix	896-929	34

Chain D: 6 helices, 0 β-strands

Element	Residues	Length
α-helix	768-778	11
α-helix	792-799	8
α-helix	805-817	13
α-helix	820-822	3
α-helix	823-834	12
α-helix	860-887	28

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Putative uncharacterized protein	A, C	protein	209	Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719)	G0RZL9 (AlphaFold model)
Putative uncharacterized protein	B, D	protein	175	Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719)	G0SG95 (AlphaFold model)

Sequence of entity 1 (A, C), FASTA

>5IC9_1 Putative uncharacterized protein (chains A, C)
LTTSLEQDPDEQDANREIAAATKQTVETLMAGERIAEALELGMTDLNTIREWEEARQINP
NIAPPQRNPIFVALGNIPAETYVLNTLQKIKPASLHDALLVLPFSTIPSLLTFLNLFAQR
ELNVPLTCRILFFVLKTHHKQIVASRTMRATLEKVRANLRAALRRQKDEMGFNIAALKVV
SMQLRDKSVREYVDETWEEKEKEKGVRKR

Sequence of entity 2 (B, D), FASTA

>5IC9_2 Putative uncharacterized protein (chains B, D)
LVEQEQTLENYIHAGAYRDAIVLALQLNHPGRLLNLFTNVVTTRNPDPDSLTGLKAVDDV
LAKLSDEQIFQLLLRLRDWNTNARTAPVAQRVLWALFKSHPANKLSSLSVKGARGHKSLN
EVLDAIKVYTERHYKRIEELVDESYLVEYTLREMDALTPQTEALEAGEDAVIAEA

Primary citation

Integrative structural analysis of the UTPB complex, an early assembly factor for eukaryotic small ribosomal subunits. Zhang, C., Sun, Q., Chen, R. et al. Nucleic Acids Res (2016) 44:7475-7486. DOI 10.1093/nar/gkw562 · PubMed

Other PDB entries of the same protein (UniProt G0RZL9 (AlphaFold model), which also has an AlphaFold model), best resolution first:

9XAG 2.8 Å, Cryo-EM structure of the 90S pre-ribosome (Enp1-Rrp12 Mut) from Chaetomium thermophilum,…
9XA8 2.9 Å, Cryo-EM structure of the 90S pre-ribosome (Enp1-Rrp12 WT) from Chaetomium thermophilum,…
9XAF 3.0 Å, Cryo-EM structure of the 90S pre-ribosome (Enp1-Rrp12 Mut) from Chaetomium thermophilum,…
9XAH 3.1 Å, Cryo-EM structure of the 90S pre-ribosome (Enp1-Rrp12 Mut) from Chaetomium thermophilum,…
5OQL 3.2 Å, Cryo-EM structure of the 90S pre-ribosome from Chaetomium thermophilum
9XA7 3.2 Å, Cryo-EM structure of the 90S pre-ribosome (Enp1-Rrp12 WT) from Chaetomium thermophilum,…
6RXU 3.5 Å, Cryo-EM structure of the 90S pre-ribosome (Kre33-Noc4) from Chaetomium thermophilum,…
5ICA 3.51 Å, Structure of the CTD complex of UTP12, Utp13, Utp1 and Utp21
6RXV 4.0 Å, Cryo-EM structure of the 90S pre-ribosome (Kre33-Noc4) from Chaetomium thermophilum,…
6RXZ 4.4 Å, Cryo-EM structure of the 90S pre-ribosome (Kre33-Noc4) from Chaetomium thermophilum,…
6RXY 4.7 Å, Cryo-EM structure of the 90S pre-ribosome (Kre33-Noc4) from Chaetomium thermophilum,…
6RXT 7.0 Å, Cryo-EM structure of the 90S pre-ribosome (Kre33-Noc4) from Chaetomium thermophilum,…

Browse structure collections

About this viewer

MolViewer shows 5IC9 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.