5J9Q: NuA4 core complex
Crystal structure of the NuA4 core complex. Determined by X-ray diffraction at 3.25 Å resolution. Released 26 Oct 2016.
- Method
- X-ray diffraction
- Resolution
- 3.25 Å
- Organisms
- Saccharomyces cerevisiae (strain ATCC 204508 / S288c), Saccharomyces cerevisiae
- Chains
- 15
- Atoms
- 19,671
- Mol. weight
- 318.35 kDa
- Released
- 26 Oct 2016
Explore 5J9Q in 3D
Show helices and sheets
RCSB PDB
PDBe
Secondary structure: helices and β-sheets
5J9Q contains 115 α-helices and 84 β-strands across 14 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
Chain A: 9 helices, 19 β-strands
| Element | Residues | Length | Sheet |
|---|
| β-strand | 161 | 1 | 13 |
| β-strand | 170-172 | 3 | 14 |
| β-strand | 175-177 | 3 | 14 |
| β-strand | 195-197 | 3 | 14 |
| β-strand | 204-205 | 2 | 14 |
| α-helix | 208-215 | 8 | |
| β-strand | 226-230 | 5 | 15 |
| β-strand | 235-240 | 6 | 15 |
| α-helix | 245-256 | 12 | |
| β-strand | 266 | 1 | 16 |
| β-strand | 271-279 | 9 | 15 |
| β-strand | 284-293 | 10 | 15 |
| β-strand | 300-302 | 3 | 17 |
| β-strand | 305-307 | 3 | 15 |
| α-helix | 309-311 | 3 | |
| α-helix | 316-331 | 16 | |
| β-strand | 335 | 1 | 18 |
| β-strand | 336-337 | 2 | 17 |
| α-helix | 343-364 | 22 | |
| α-helix | 370-377 | 8 | |
| β-strand | 379 | 1 | 18 |
| α-helix | 381-390 | 10 | |
| β-strand | 394-396 | 3 | 10 |
| β-strand | 401-404 | 4 | 10 |
| α-helix | 407-418 | 12 | |
| α-helix | 426-428 | 3 | |
| β-strand | 429 | 1 | 15 |
| β-strand | 437 | 1 | 1 |
Chain B: 4 helices, 2 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 2-43 | 42 | |
| β-strand | 68 | 1 | 30 |
| β-strand | 72 | 1 | 30 |
| α-helix | 90-92 | 3 | |
| α-helix | 96-98 | 3 | |
| α-helix | 100-103 | 4 | |
Chain C: 23 helices, 7 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 64 | 1 | |
| β-strand | 65-66 | 2 | 25 |
| β-strand | 73-75 | 3 | 28 |
| β-strand | 121-123 | 3 | 28 |
| α-helix | 124-127 | 4 | |
| β-strand | 128-129 | 2 | 14 |
| α-helix | 130 | 1 | |
| α-helix | 133-136 | 4 | |
| α-helix | 142-144 | 3 | |
| α-helix | 147-148 | 2 | |
| α-helix | 154-157 | 4 | |
| α-helix | 166-171 | 6 | |
| α-helix | 172-176 | 5 | |
| α-helix | 186-203 | 18 | |
| α-helix | 207-209 | 3 | |
| α-helix | 211-213 | 3 | |
| α-helix | 214-216 | 3 | |
| α-helix | 217-226 | 10 | |
| α-helix | 232-242 | 11 | |
| α-helix | 256-258 | 3 | |
| α-helix | 264-267 | 4 | |
| α-helix | 268-272 | 5 | |
| α-helix | 273-285 | 13 | |
| β-strand | 296-297 | 2 | 29 |
| α-helix | 298-299 | 2 | |
| β-strand | 310-311 | 2 | 29 |
| β-strand | 313 | 1 | 16 |
| α-helix | 318-321 | 4 | |
| α-helix | 328-382 | 55 | |
| α-helix | 389-391 | 3 | |
Chains D and K: 4 helices, 0 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 3-14 | 12 | |
| α-helix | 17-56 | 40 | |
| α-helix | 61-62 | 2 | |
| α-helix | 65-113 | 49 | |
Chain E: 10 helices, 20 β-strands
| Element | Residues | Length | Sheet |
|---|
| β-strand | 161 | 1 | 1 |
| β-strand | 170-172 | 3 | 2 |
| β-strand | 175-177 | 3 | 2 |
| α-helix | 189-191 | 3 | |
| β-strand | 195-197 | 3 | 2 |
| β-strand | 204-205 | 2 | 2 |
| α-helix | 208-217 | 10 | |
| β-strand | 226-230 | 5 | 3 |
| β-strand | 235-240 | 6 | 3 |
| α-helix | 245-256 | 12 | |
| β-strand | 262 | 1 | 4 |
| β-strand | 266 | 1 | 5 |
| β-strand | 271-279 | 9 | 3 |
| β-strand | 284-293 | 10 | 3 |
| β-strand | 300-302 | 3 | 6 |
| β-strand | 305-307 | 3 | 3 |
| α-helix | 309-311 | 3 | |
| α-helix | 316-331 | 16 | |
| β-strand | 335 | 1 | 7 |
| β-strand | 336-337 | 2 | 6 |
| α-helix | 343-364 | 22 | |
| α-helix | 370-377 | 8 | |
| β-strand | 379 | 1 | 7 |
| α-helix | 381-390 | 10 | |
| β-strand | 394-396 | 3 | 8 |
| β-strand | 401-403 | 3 | 8 |
| α-helix | 407-418 | 12 | |
| α-helix | 426-428 | 3 | |
| β-strand | 429 | 1 | 3 |
| β-strand | 437 | 1 | 9 |
Chains F and J: 3 helices, 0 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 2-43 | 42 | |
| α-helix | 90-92 | 3 | |
| α-helix | 96-98 | 3 | |
Chain G: 20 helices, 7 β-strands
| Element | Residues | Length | Sheet |
|---|
| β-strand | 65-67 | 3 | 10 |
| β-strand | 73-74 | 2 | 11 |
| β-strand | 122-123 | 2 | 11 |
| α-helix | 124-127 | 4 | |
| β-strand | 128-129 | 2 | 2 |
| α-helix | 130 | 1 | |
| α-helix | 133-136 | 4 | |
| α-helix | 142-144 | 3 | |
| α-helix | 147-148 | 2 | |
| α-helix | 154-157 | 4 | |
| α-helix | 166-171 | 6 | |
| α-helix | 172-176 | 5 | |
| α-helix | 186-203 | 18 | |
| α-helix | 207-209 | 3 | |
| α-helix | 211-213 | 3 | |
| α-helix | 214-216 | 3 | |
| α-helix | 217-226 | 10 | |
| α-helix | 232-241 | 10 | |
| α-helix | 256-258 | 3 | |
| α-helix | 264-267 | 4 | |
| α-helix | 268-272 | 5 | |
| α-helix | 273-285 | 13 | |
| β-strand | 296 | 1 | 12 |
| α-helix | 298-299 | 2 | |
| β-strand | 310 | 1 | 12 |
| β-strand | 313 | 1 | 5 |
| α-helix | 328-382 | 55 | |
Chain H: 4 helices, 0 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 3-14 | 12 | |
| α-helix | 17-55 | 39 | |
| α-helix | 61-62 | 2 | |
| α-helix | 65-113 | 49 | |
3 more chain groups are not listed. Open the entry in the viewer and use the sequence panel to see them.
Molecules and chains
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|
| Histone acetyltransferase ESA1 | A, E, I | protein | 305 | Saccharomyces cerevisiae (strain ATCC 204508 / S288c) | Q08649 (AlphaFold model) |
| Chromatin modification-related protein EAF6 | B, F, J | protein | 113 | Saccharomyces cerevisiae (strain ATCC 204508 / S288c) | P47128 (AlphaFold model) |
| Enhancer of polycomb-like protein 1 | C, G, N | protein | 351 | Saccharomyces cerevisiae (strain ATCC 204508 / S288c) | P43572 (AlphaFold model) |
| Chromatin modification-related protein YNG2 | D, H, K | protein | 120 | Saccharomyces cerevisiae (strain ATCC 204508 / S288c) | P38806 (AlphaFold model) |
| Htz1 | L, M, O | protein | 10 | Saccharomyces cerevisiae | Q12692 |
Sequence of entity 1 (A, E, I), FASTA
>5J9Q_1 Histone acetyltransferase ESA1 (chains A, E, I)
HEDEIKKLRTSGSMTQNPHEVARVRNLNRIIMGKYEIEPWYFSPYPIELTDEDFIYIDDF
TLQYFGSKKQYERYRKKCTLRHPPGNEIYRDDYVSFFEIDGRKQRTWCRNLCLLSKLFLD
HKTLYYDVDPFLFYCMTRRDELGHHLVGYFSKEKESADGYNVACILTLPQYQRMGYGKLL
IEFSYELSKKENKVGSPQKPLSDLGLLSYRAYWSDTLITLLVEHQKEITIDEISSMTSMT
TTDILHTAKTLNILRYYKGQHIIFLNEDILDRYNRLKAKKRRTIDPNRLIWKPPVFTASQ
LRFAW
Sequence of entity 2 (B, F, J), FASTA
>5J9Q_2 Chromatin modification-related protein EAF6 (chains B, F, J)
MTDELKSYEALKAELKKSLQDRREQEDTFDNLQQEIYDKETEYFSHNSNNNHSGHGGAHG
SKSHYSGNIIKGFDTFSKSHHSHADSAFNNNDRIFSLSSATYVKQQHGQSQND
Sequence of entity 3 (C, G, N), FASTA
>5J9Q_3 Enhancer of polycomb-like protein 1 (chains C, G, N)
SSNSRFRHRKISVKQHLKIYLPNDLKHLDKDELQQREVVEIETGVEKNEEKEVHLHRILQ
MGSGHTKHKDYIPTPDASMTWNEYDKFYTGSFQETTSYIKFSATVEDCCGTNYNMDERDE
TFLNEQVNKGSSDILTEDEFEILCSSFEHAIHERQPFLSMDPESILSFEELKPTLIKSDM
ADFNLRNQLNHEINSHKTHFITQFDPVSQMNTRPLIQLIEKFGSKIYDYWRERKIEVNGY
EIFPQLKFERPGEKEEIDPYVCFRRREVRHPRKTRRIDILNSQRLRALHQELKNAKDLAL
LVAKRENVSLNWINDELKIFDQRVKIKNLKRSLNISGEDDDLINHKRKRPT
Sequence of entity 4 (D, H, K), FASTA
>5J9Q_4 Chromatin modification-related protein YNG2 (chains D, H, K)
MDPSLVLEQTIQDVSNLPSEFRYLLEEIGSNDLKLIEEKKKYEQKESQIHKFIRQQGSIP
KHPQEDGLDKEIKESLLKCQSLQREKCVLANTALFLIARHLNKLEKNIALLEEDGVLAPV
Sequence of entity 5 (L, M, O), FASTA
>5J9Q_5 Htz1 (chains L, M, O)
SGAKDSGSLR
Primary citation
The NuA4 Core Complex Acetylates Nucleosomal Histone H4 through a Double Recognition Mechanism. Xu, P., Li, C., Chen, Z. et al. Mol Cell (2016) 63:965-975. DOI 10.1016/j.molcel.2016.07.024 · PubMed
Other PDB entries of the same protein (UniProt Q08649 (AlphaFold model), which also has an AlphaFold model), best resolution first:
- 3TO7 1.9 Å, Crystal structure of yeast Esa1 HAT domain bound to coenzyme A with active site lysine…
- 1FY7 2.0 Å, Crystal structure of yeast ESA1 histone acetyltransferase domain complexed with coenzyme a
- 3TO9 2.0 Å, Crystal structure of yeast Esa1 E338Q HAT domain bound to coenzyme A with active site…
- 3TO6 2.1 Å, Crystal structure of yeast Esa1 HAT domain complexed with H4K16CoA bisubstrate inhibitor
- 1MJA 2.26 Å, Crystal structure of yeast Esa1 histone acetyltransferase domain complexed with acetyl…
- 1MJ9 2.5 Å, Crystal structure of yeast Esa1(C304S) mutant complexed with Coenzyme A
- 1MJB 2.5 Å, Crystal structure of yeast Esa1 histone acetyltransferase E338Q mutant complexed with…
- 5J9T 2.7 Å, Crystal structure of the NuA4 core complex
- 5J9W 2.8 Å, Crystal structure of the NuA4 core complex
- 5J9U 2.95 Å, Crystal structure of the NuA4 core complex
- 7VVU 3.4 Å, NuA4 HAT module bound to the nucleosome
- 8X2X 3.8 Å, The piccolo NuA4 bound to the H2A.Z nucleosome complex at pre-H4-acetylation state
Browse structure collections
About this viewer
MolViewer shows 5J9Q directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.