5JHV: Polymerase acidic protein

Apo form of influenza strain H1N1 polymerase acidic subunit N-terminal region crystallized with polyethylene glycol 8000. Determined by X-ray diffraction at 2.75 Å resolution. Released 11 May 2016.

Method: X-ray diffraction
Resolution: 2.75 Å
Organism: Influenza A virus
Chains: 2
Atoms: 3,024
Mol. weight: 44.82 kDa
Ligands: MN
Released: 11 May 2016

Explore 5JHV in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

5JHV contains 17 α-helices and 10 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 8 helices, 5 β-strands

Element	Residues	Length	Sheet
α-helix	1-8	8
α-helix	11-22	12
α-helix	32-50	19
β-strand	76-78	3	1
α-helix	84-98	15
β-strand	109-111	3	1
β-strand	116-123	8	1
α-helix	127-137	11
β-strand	144-149	6	1
β-strand	154-156	3	1
α-helix	157-159	3
α-helix	165-183	19
α-helix	188-194	7

Chain B: 9 helices, 5 β-strands

Element	Residues	Length	Sheet
α-helix	1-8	8
α-helix	11-22	12
α-helix	32-51	20
β-strand	76-78	3	2
α-helix	84-98	15
α-helix	100-103	4
β-strand	109-111	3	2
β-strand	116-123	8	2
α-helix	127-138	12
β-strand	144-149	6	2
β-strand	154-156	3	2
α-helix	157-159	3
α-helix	165-185	21
α-helix	188-194	7

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Polymerase acidic protein	A, B	protein	191	Influenza A virus	P03433 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>5JHV_1 Polymerase acidic protein (chains A, B)
GPLGSMEDFVRQCFNPMIVELAEKTMKEYGEDLKIETNKFAAICTHLEVCFMYSDASKHR
FEIIEGRDRTMAWTVVNSICNTTGAEKPKFLPDLYDYKENRFIEIGVTRREVHIYYLEKA
NKIKSEKTHIHIFSFTGEEMATKADYTLDEESRARIKTRLFTIRQEMASRGLWDSFRQSE
RGAAELALVPR

Ligands and cofactors

ID	Name	Formula	Copies
MN	Manganese (II) ion	Mn	4

Primary citation

Influence of Precipitants on Molecular Arrangements and Space Groups of Protein Crystals. Fudo, S., Fei, Q., Nukaga, M. et al. Cryst Growth Des (2017) 17:534-542. DOI 10.1021/acs.cgd.6b01385

Other PDB entries of the same protein (UniProt P03433 (AlphaFold model), which also has an AlphaFold model), best resolution first:

7XGC 1.6 Å, Crystal structure of influenza polymerase acidic subunit N-terminal domain crystallized…
5JHT 1.75 Å, Apo form of influenza strain H1N1 polymerase acidic subunit N-terminal region…
4ZQQ 1.8 Å, Apo form of influenza strain H1N1 polymerase acidic subunit N-terminal region
4ZI0 1.8 Å, Endonuclease inhibitor bound to influenza strain H1N1 polymerase acidic subunit…
4YYL 1.91 Å, Phenolic acid derivative bound to influenza strain H1N1 polymerase subunit PA endonuclease
5FDG 2.1 Å, Endonuclease inhibitor 3 bound to influenza strain H1N1 polymerase acidic subunit…
5I13 2.15 Å, Endonuclease inhibitor 2 bound to influenza strain H1N1 polymerase acidic subunit…
2ZNL 2.3 Å, Crystal structure of PA-PB1 complex form influenza virus RNA polymerase
4ZHZ 2.5 Å, Endonuclease inhibitor bound to influenza strain H1N1 polymerase acidic subunit…
5FDD 2.51 Å, Endonuclease inhibitor 1 bound to influenza strain H1N1 polymerase acidic subunit…

Browse structure collections

About this viewer

MolViewer shows 5JHV directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.