Crystal structure of Staphylococcal nuclease variant Delta+PHS L25K/I92A at cryogenic temperature. Determined by X-ray diffraction at 1.45 Å resolution. Released 11 May 2016.
Explore 5JOB in 3D Show helices and sheets RCSB PDB PDBe
5JOB contains 5 α-helices and 11 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 10-12 | 3 | 1 |
| β-strand | 13-17 | 5 | 2 |
| β-strand | 22-27 | 6 | 2 |
| β-strand | 30-36 | 7 | 2 |
| β-strand | 39-40 | 2 | 3 |
| α-helix | 41-43 | 3 | |
| α-helix | 55-67 | 13 | |
| β-strand | 72-75 | 4 | 1 |
| β-strand | 82 | 1 | 2 |
| β-strand | 88-90 | 3 | 2 |
| β-strand | 91-94 | 4 | 1 |
| β-strand | 97-98 | 2 | 1 |
| α-helix | 99-105 | 7 | |
| β-strand | 110-111 | 2 | 3 |
| α-helix | 122-134 | 13 | |
| α-helix | 138-140 | 3 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Thermonuclease | A | protein | 143 | Staphylococcus aureus | P00644 (AlphaFold model) |
>5JOB_1 Thermonuclease (chains A) ATSTKKLHKEPATLIKAIDGDTVKKMYKGQPMTFRLLLVDTPEFNEKYGPEASAFTKKMV ENAKKIEVEFDKGQRTDKYGRGLAYAYADGKMVNEALVRQGLAKVAYVYKGNNTHEQLLR KAEAQAKKEKLNIWSEDNADSGQ
Crystal structure of Staphylococcal nuclease variant Delta+PHS L25K/I92A at cryogenic temperature. Skerritt, L.A., Caro, J.A., Heroux, A. et al. To be published.
Other PDB entries of the same protein (UniProt P00644 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 5JOB directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.