1.9 angstrom A2a adenosine receptor structure with sulfur SAD phasing and phase extension using XFEL data. Determined by X-ray diffraction at 1.9 Å resolution. Released 21 Sept 2016.
Explore 5K2C in 3D Show helices and sheets RCSB PDB PDBe
5K2C contains 22 α-helices and 2 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 2-33 | 32 | |
| α-helix | 35-37 | 3 | |
| α-helix | 40-54 | 15 | |
| α-helix | 55-59 | 5 | |
| α-helix | 60-67 | 8 | |
| β-strand | 71-73 | 3 | 1 |
| α-helix | 74-107 | 34 | |
| α-helix | 109-115 | 7 | |
| α-helix | 118-136 | 19 | |
| α-helix | 138-141 | 4 | |
| α-helix | 151-156 | 6 | |
| β-strand | 163-165 | 3 | 1 |
| α-helix | 168-171 | 4 | |
| α-helix | 174-175 | 2 | |
| α-helix | 176-187 | 12 | |
| α-helix | 188-1019 | 40 | |
| α-helix | 1023-1042 | 20 | |
| α-helix | 1057-1080 | 24 | |
| α-helix | 1084-1097 | 14 | |
| α-helix | 1098-1102 | 5 | |
| α-helix | 1103-258 | 44 | |
| α-helix | 263-266 | 4 | |
| α-helix | 267-291 | 25 | |
| α-helix | 293-306 | 14 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Adenosine receptor A2a/Soluble cytochrome b562 chimera | A | protein | 447 | Homo sapiens, Escherichia coli | P0ABE7 (AlphaFold model), P29274 (AlphaFold model) |
>5K2C_1 Adenosine receptor A2a/Soluble cytochrome b562 chimera (chains A) MKTIIALSYIFCLVFADYKDDDDGAPPIMGSSVYITVELAIAVLAILGNVLVCWAVWLNS NLQNVTNYFVVSLAAADIAVGVLAIPFAITISTGFCAACHGCLFIACFVLVLTQSSIFSL LAIAIDRYIAIRIPLRYNGLVTGTRAKGIIAICWVLSFAIGLTPMLGWNNCGQPKEGKNH SQGCGEGQVACLFEDVVPMNYMVYFNFFACVLVPLLLMLGVYLRIFLAARRQLADLEDNW ETLNDNLKVIEKADNAAQVKDALTKMRAAALDAQKATPPKLEDKSPDSPEMKDFRHGFDI LVGQIDDALKLANEGKVKEAQAAAEQLKTTRNAYIQKYLERARSTLQKEVHAAKSLAIIV GLFALCWLPLHIINCFTFFCPDCSHAPLWLMYLAIVLSHTNSVVNPFIYAYRIREFRQTF RKIIRSHVLRQQEPFKAHHHHHHHHHH
| ID | Name | Formula | Copies |
|---|---|---|---|
| ZMA | 4-{2-[(7-amino-2-furan-2-yl[1,2,4]triazolo[1,5-a][1,3,5]triazin-5-yl)amino]ethy… | C16 H15 N7 O2 | 1 |
| OLA | Oleic acid | C18 H34 O2 | 11 |
| OLC | (2R)-2,3-dihydroxypropyl (9Z)-octadec-9-enoate | C21 H40 O4 | 10 |
| CLR | Cholesterol | C27 H46 O | 3 |
Water and common crystallization additives (PEG, NA) are not listed.
Native phasing of x-ray free-electron laser data for a G protein-coupled receptor. Batyuk, A., Galli, L., Ishchenko, A. et al. Sci Adv (2016) 2:e1600292-e1600292. DOI 10.1126/sciadv.1600292 · PubMed
Other PDB entries of the same protein (UniProt P0ABE7 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 5K2C directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.