5K3Q: Rhesus macaques Trim5alpha Bbox2 domain

Rhesus macaques Trim5alpha Bbox2 domain. Determined by X-ray diffraction at 1.8 Å resolution. Released 20 Jul 2016.

Method: X-ray diffraction
Resolution: 1.8 Å
Organism: Macaca mulatta
Chains: 4
Atoms: 1,466
Mol. weight: 47.57 kDa
Ligands: ZN
Released: 20 Jul 2016

Explore 5K3Q in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

5K3Q contains 9 α-helices and 20 β-strands across 4 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 3 helices, 5 β-strands

Element	Residues	Length	Sheet
β-strand	96	1	1
β-strand	103	1	1
β-strand	106-108	3	2
β-strand	113-115	3	2
α-helix	117-121	5
α-helix	123-125	3
β-strand	130-132	3	2
α-helix	133-135	3

Chains B and D: 2 helices, 5 β-strands

Element	Residues	Length	Sheet
β-strand	96	1	3
β-strand	103	1	3
β-strand	106-108	3	4
β-strand	113-115	3	4
α-helix	117-121	5
α-helix	123-125	3
β-strand	130-132	3	4

Chain C: 2 helices, 5 β-strands

Element	Residues	Length	Sheet
β-strand	96	1	5
β-strand	103	1	5
β-strand	106-108	3	6
β-strand	113-115	3	6
α-helix	117-120	4
α-helix	123-125	3
β-strand	130-132	3	6

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Tripartite motif-containing protein 5,Tripartite motif-containing protein 5	A, B, C, D	protein	101	Macaca mulatta	Q0PF16 (AlphaFold model)

Sequence of entity 1 (A, B, C, D), FASTA

>5K3Q_1 Tripartite motif-containing protein 5,Tripartite motif-containing protein 5 (chains A, B, C, D)
GPGVDHCARHGEKLLLFCQEDSKVICWLCERSQEHRGHHTFLMEEVAQEYHVKLQTALEM
LRQKGGDPYMRELISELEHRLQGSMMDLLQGVDGIIKRIEN

Ligands and cofactors

ID	Name	Formula	Copies
ZN	Zinc ion	Zn	8

Water and common crystallization additives (NO3) are not listed.

Primary citation

Crystal structure of the Trim5 alpha Bbox2 domain from rhesus macaques describes a plastic oligomerisation interface. Keown, J.R., Goldstone, D.C. J Struct Biol (2016) 195:282-285. DOI 10.1016/j.jsb.2016.07.004 · PubMed

Other PDB entries of the same protein (UniProt Q0PF16 (AlphaFold model), which also has an AlphaFold model), best resolution first:

3UV9 1.55 Å, Structure of the rhesus monkey TRIM5alpha deltav1 PRYSPRY domain
5EIU 1.91 Å, Mini TRIM5 B-box 2 dimer C2 crystal form
4TKP 2.08 Å, Complex of Ubc13 with the RING domain of the TRIM5alpha retroviral restriction factor
5F7T 2.29 Å, TRIM5 B-box2 and coiled-coil chimera
5W9A 2.74 Å, The structure of the Trim5alpha Bbox- coiled coil in complex LC3B
5IEA 3.26 Å, TRIM5 B-box2 and coiled-coil chimera
4B3N 3.3 Å, Crystal structure of rhesus TRIM5alpha PRY/SPRY domain
2LM3 Structure of the rhesus monkey TRIM5alpha PRYSPRY domain

Browse structure collections

About this viewer

MolViewer shows 5K3Q directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.