5KVE: Zika specific antibody, ZV-48

Zika specific antibody, ZV-48, bound to ZIKA envelope DIII. Determined by X-ray diffraction at 1.7 Å resolution. Released 10 Aug 2016.

Method: X-ray diffraction
Resolution: 1.7 Å
Organisms: Zika virus, Mus musculus
Chains: 2
Atoms: 3,210
Mol. weight: 39.07 kDa
Released: 10 Aug 2016

Explore 5KVE in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

5KVE contains 12 α-helices and 36 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain E: 4 helices, 12 β-strands

Element	Residues	Length	Sheet
α-helix	306	1
β-strand	307	1	1
α-helix	308	1
β-strand	312-314	3	2
β-strand	319-320	2	2
β-strand	326-332	7	2
β-strand	339-340	2	1
α-helix	341-342	2
β-strand	343-346	4	3
β-strand	354-355	2	3
β-strand	357-358	2	2
β-strand	364-365	2	1
β-strand	372-379	8	2
α-helix	380-381	2
β-strand	383-389	7	3
β-strand	396-402	7	3

Chain L: 8 helices, 24 β-strands

Element	Residues	Length	Sheet
α-helix	1-3	3
β-strand	4-7	4	4
β-strand	10-13	4	5
β-strand	19-25	7	4
β-strand	30-31	2	6
β-strand	36-37	2	6
β-strand	39-44	6	5
β-strand	51-55	5	5
β-strand	59-60	2	5
α-helix	61	1
β-strand	68-73	6	4
β-strand	76-81	6	4
α-helix	86-88	3
β-strand	90-96	7	5
α-helix	102	1
β-strand	103-104	2	5
β-strand	108-112	5	5
β-strand	131-133	3	7
β-strand	138-140	3	5
β-strand	146-153	8	7
β-strand	162-167	6	5
β-strand	174-179	6	5
β-strand	186-188	3	5
α-helix	190-192	3
β-strand	196-201	6	7
α-helix	202-204	3
β-strand	206-211	6	7
α-helix	216-218	3
β-strand	220-226	7	5
α-helix	229-231	3
β-strand	233-234	2	5
β-strand	238-242	5	5

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Genome polyprotein	E	protein	110	Zika virus	A0A024B7W1 (AlphaFold model)
ZV-48 Antibody scFv	L	protein	245	Mus musculus

Sequence of entity 1 (E), FASTA

>5KVE_1 Genome polyprotein (chains E)
MRLKGVSYSLCTAAFTFTKIPAETLHGTVTVEVQYAGTDGPCKVPAQMAVDMQTLTPVGR
LITANPVITESTENSKMMLELDPPFGDSYIVIGVGEKKITHHWHRSGSTI

Sequence of entity 2 (L), FASTA

>5KVE_2 ZV-48 Antibody scFv (chains L)
MDIVMSQSPSSLAVSVGEKITMSCKSSQSLLYSNNEKNYLAWYQQKPGQSPKLLIYWASA
RDSGVPDRFTGSGSGTDFTLTISSVKAEDLAVFYCQQYYSYPYTFGGGTKLEIKGGGGSG
GGGSGGGGSQVQLQQPGAELLKPGASVKLSCKASGYSFSNYWMHWVKQRPGQGPEWIGMI
HPNSGNTKYNEKFKNKATLTVDKSSSMVYMQLSSLTSEDSAVFYCARLGNDMDYWGQGTS
VTVSS

Primary citation

Structural Basis of Zika Virus-Specific Antibody Protection. Zhao, H., Fernandez, E., Dowd, K.A. et al. Cell (2016) 166:1016-1027. DOI 10.1016/j.cell.2016.07.020 · PubMed

Other PDB entries of the same protein (UniProt A0A024B7W1 (AlphaFold model), which also has an AlphaFold model), best resolution first:

5KQR 1.33 Å, Structure of NS5 methyltransferase from Zika virus bound to S-adenosylmethionine
6LD1 1.4 Å, Zika NS5 polymerase domain
6LD2 1.4 Å, Zika NS5 polymerase domain
5KQS 1.5 Å, Structure of NS5 methyltransferase from Zika virus bound to S-adenosylmethionine and…
6LD4 1.5 Å, Zika NS5 polymerase domain
6S0J 1.5 Å, Structure of Zika virus NS3 helicase in complex with ADP-MgF3(H2O)-
5ULP 1.55 Å, Structure of the NS5 methyltransferase from Zika bound to MS2042
5Y6N 1.57 Å, Zika virus helicase in complex with ADP
7M1V 1.6 Å, Structure of Zika virus NS2b-NS3 protease mutant binding the compound NSC86314 in the…
6RWZ 1.7 Å, Structure of Zika virus NS3 helicase in complex with ADP-BeF3
5JMT 1.8 Å, Crystal structure of Zika virus NS3 helicase
5MRK 1.9 Å, Structural basis of Zika virus methyltransferase inhibition by sinefungin

Browse structure collections

About this viewer

MolViewer shows 5KVE directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.