5KWQ: Poly-binding-splicing factor PUF60

Name: PDB 5KWQ: Two Tandem RRM Domains of FBP-Interacting Repressor (FIR), also Known as PUF60
Published: 2017-08-23
License: https://creativecommons.org/publicdomain/zero/1.0/
Keywords: splicing

Two Tandem RRM Domains of FBP-Interacting Repressor (FIR), also Known as PUF60. Determined by X-ray diffraction at 2.8 Å resolution. Released 23 Aug 2017.

Method: X-ray diffraction
Resolution: 2.8 Å
Organism: Homo sapiens
Chains: 2
Atoms: 2,896
Mol. weight: 46.82 kDa
Released: 23 Aug 2017

Explore 5KWQ in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

5KWQ contains 16 α-helices and 16 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chains A and B: 8 helices, 8 β-strands

Element	Residues	Length	Sheet
α-helix	101-110	10
β-strand	113-117	5	1
α-helix	125-132	8
α-helix	133-135	3
β-strand	138-143	6	1
β-strand	156-160	5	1
α-helix	163-172	10
β-strand	184-186	3	1
α-helix	191-194	4
α-helix	195-205	11
β-strand	209-214	6	2
α-helix	222-230	9
β-strand	235-242	8	2
β-strand	249-257	9	2
α-helix	260-270	11
β-strand	281-284	4	2

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Poly(U)-binding-splicing factor PUF60	A, B	protein	216	Homo sapiens	Q9UHX1 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>5KWQ_1 Poly(U)-binding-splicing factor PUF60 (chains A, B)
GSHMASMTGGQQMGRGSAAQRQGALAIMSRVYVGSIYYELGEDTIRQAFAPFGPIKSIDM
SWDSVTMKHKGFAFVEYEVPEAAQLALEQMNSVMLGGRNIKVGRPSNIGQAQPIIDQLAE
EARAFNRIYVASVHQDLSDDDIKSVFEAFGKIKSATLARDPTTGKHKGYGFIEYEKAQSS
QDAVSSMNLFDLGGQYLRVGKAVTPPMPLLTPATPG

Primary citation

Unraveling the mechanism of recognition of the 3' splice site of the adenovirus major late promoter intron by the alternative splicing factor PUF60. Hsiao, H.T., Crichlow, G.V., Murphy, J.W. et al. PLoS One (2020) 15:e0242725-e0242725. DOI 10.1371/journal.pone.0242725 · PubMed

Other PDB entries of the same protein (UniProt Q9UHX1 (AlphaFold model), which also has an AlphaFold model), best resolution first:

3UE2 1.23 Å, Crystal structure of a RNA binding domain of poly-U binding splicing factor 60KDa…
3US5 1.38 Å, Crystal structure of a RNA-binding domain of a poly-U binding splicing factor 60KDa…
7Z3X 1.65 Å, Crystal structure of FIR RRM1-2 Y115F mutant bound to FUSE ssDNA
5KW6 1.91 Å, Two Tandem RRM Domains of PUF60 Bound to an AdML Pre-mRNA 3' Splice Site Analogue with a…
5KVY 1.95 Å, Crystal structure of the two tandem rrm domains of PUF60 bound to a portion of an adml…
6LUR 2.0 Å, Human PUF60 UHM domain (thioredoxin fusion) in complex with a small molecule binder
7Q8A 2.05 Å, Crystal structure of tandem domain RRM1-2 of FUBP-interacting repressor (FIR) bound to…
2QFJ 2.1 Å, Crystal Structure of First Two RRM Domains of FIR Bound to ssDNA from a Portion of FUSE
5KW1 2.1 Å, Crystal Structure of the Two Tandem RRM Domains of PUF60 Bound to a Modified AdML…
3DXB 2.2 Å, Structure of the UHM domain of Puf60 fused to thioredoxin
3UWT 2.5 Å, Crystal structure of a RNA binding domain of poly-U binding splicing factor 60KDa…
2DNY Solution structure of the third RNA binding domain of FBP-interacting repressor, SIAHBP1

Browse structure collections

About this viewer

MolViewer shows 5KWQ directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.