Crystal structure of the complex between the N-terminal SH3 domain of CrkII and a proline-rich ligand. Determined by X-ray diffraction at 1.77 Å resolution. Released 7 Sept 2016.
Explore 5L23 in 3D Show helices and sheets RCSB PDB PDBe
5L23 contains 2 α-helices and 8 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 136-139 | 4 | 1 |
| β-strand | 143 | 1 | 2 |
| β-strand | 150 | 1 | 1 |
| β-strand | 153 | 1 | 2 |
| β-strand | 158-163 | 6 | 1 |
| β-strand | 169-173 | 5 | 1 |
| β-strand | 179-183 | 5 | 1 |
| α-helix | 184-186 | 3 | |
| β-strand | 187-189 | 3 | 1 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 0-8 | 9 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Adapter molecule crk | A | protein | 58 | Mus musculus | Q64010 (AlphaFold model) |
| C3G derived peptide | B | protein | 17 | Mus musculus | Q13905 (AlphaFold model) |
>5L23_1 Adapter molecule crk (chains A) AEYVRALFDFNGNDEEDLPFKKGDILRIRDKPEEQWWNAEDSEGKRGMIPVPYVEKYR
>5L23_2 C3G derived peptide (chains B) XDNSPPPALPKKRQSYX
Crystal structure of the complex between the N-terminal SH3 domain of CrkII and a proline-rich ligand. Bhatt, V.S., Krieger, I., Sacchettini, J. et al. To be published.
Other PDB entries of the same protein (UniProt Q64010 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 5L23 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.