5L7G: MCR

MCR IN COMPLEX WITH ligand. Determined by X-ray diffraction at 2.01 Å resolution. Released 7 Dec 2016.

Method: X-ray diffraction
Resolution: 2.01 Å
Organism: Homo sapiens
Chains: 2
Atoms: 2,258
Mol. weight: 36.52 kDa
Ligands: 6QE
Released: 7 Dec 2016

Explore 5L7G in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

5L7G contains 13 α-helices and 4 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 12 helices, 4 β-strands

Element	Residues	Length	Sheet
α-helix	738-745	8
α-helix	747-749	3
α-helix	762-785	24
α-helix	790-792	3
α-helix	795-822	28
β-strand	827-830	4	1
β-strand	833-835	3	1
α-helix	837-842	6
α-helix	846-862	17
α-helix	866-877	12
β-strand	880-882	3	2
α-helix	889-907	19
α-helix	918-929	12
α-helix	931-947	17
α-helix	958-972	15
β-strand	976-978	3	2

Chain B: 1 helix, 0 β-strands

Element	Residues	Length	Sheet
α-helix	1434-1440	7

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Mineralocorticoid receptor	A	protein	305	Homo sapiens	P08235 (AlphaFold model)
NCOA1 peptide	B	protein	10	Homo sapiens	Q15788 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>5L7G_1 Mineralocorticoid receptor (chains A)
MHNHNHNHNHNHNGGENLYFQGTPSPVMVLENIEPEIVYAGYDSSKPDTAENLLSTLNRL
AGKQMIQVVKWAKVLPGFKNLPLEDQITLIQYSWMSLLSFALSWRSYKHTNSQFLYFAPD
LVFNEEKMHQSAMYELCQGMHQISLQFVRLQLTFEEYTIMKVLLLLSTIPKDGLKSQAAF
EEMRTNYIKELRKMVTKSPNNSGQSWQRFYQLTKLLDSMHDLVSDLLEFCFYTFRESHAL
KVEFPAMLVEIISDQLPKVESGNAKPLYFHRKGGSLVPRGSGGGSGGSGGPQAQQKSLLQ
QLLTE

Sequence of entity 2 (B), FASTA

>5L7G_2 NCOA1 peptide (chains B)
KSLLQQLLTE

Ligands and cofactors

ID	Name	Formula	Copies
6QE	~{N}-[[4-[5-[[2,3-bis(fluoranyl)phenoxy]methyl]-3-methyl-1,2-oxazol-4-yl]phenyl…	C22 H22 F2 N2 O4 S	1

Water and common crystallization additives (EDO) are not listed.

Primary citation

Structure-Based Drug Design of Mineralocorticoid Receptor Antagonists to Explore Oxosteroid Receptor Selectivity. Nordqvist, A., O'Mahony, G., Friden-Saxin, M. et al. ChemMedChem (2017) 12:50-65. DOI 10.1002/cmdc.201600529 · PubMed

Other PDB entries of the same protein (UniProt P08235 (AlphaFold model), which also has an AlphaFold model), best resolution first:

4PF3 1.1 Å, Mineralocorticoid receptor ligand-binding domain with compuond 37a
3VHV 1.35 Å, Mineralocorticoid receptor ligand-binding domain with non-steroidal antagonist
3WFG 1.4 Å, Mineralocorticoid receptor ligand-binding domain with compuond 2e
9GC7 1.46 Å, Mineralocorticoid receptor in complex with acylurea antagonists.
6GEV 1.54 Å, Mineralocorticoid receptor in complex with (s)-13
6GGG 1.71 Å, Mineralocorticoid receptor in complex with (s)-13
2AAX 1.75 Å, Mineralocorticoid Receptor Double Mutant with Bound Cortisone
5MWY 1.75 Å, The structure of MR in complex with eplerenone.
6GG8 1.8 Å, Mineralocorticoid receptor in complex with (s)-13
5MWP 1.82 Å, The structure of MR in complex with AZD9977.
5L7H 1.84 Å, MCR IN COMPLEX WITH ligand
2AB2 1.85 Å, Mineralocorticoid Receptor Double Mutant with Bound Spironolactone

Browse structure collections

About this viewer

MolViewer shows 5L7G directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.