Crystal structure of Smad4-MH1 bound to the GGCCG site. Determined by X-ray diffraction at 3.03 Å resolution. Released 15 Nov 2017.
Explore 5MF0 in 3D Show helices and sheets RCSB PDB PDBe
5MF0 contains 14 α-helices and 14 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 17-24 | 8 | |
| β-strand | 28 | 1 | 1 |
| α-helix | 33-46 | 14 | |
| α-helix | 51-62 | 12 | |
| β-strand | 73-75 | 3 | 2 |
| α-helix | 76-77 | 2 | |
| β-strand | 82-84 | 3 | 3 |
| β-strand | 87-89 | 3 | 3 |
| α-helix | 91-99 | 9 | |
| β-strand | 109-111 | 3 | 4 |
| α-helix | 119-121 | 3 | |
| β-strand | 125-127 | 3 | 2 |
| α-helix | 130-132 | 3 | |
| β-strand | 133-135 | 3 | 4 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 16-24 | 9 | |
| β-strand | 28 | 1 | 1 |
| α-helix | 33-46 | 14 | |
| α-helix | 51-62 | 12 | |
| β-strand | 73-75 | 3 | 5 |
| α-helix | 76-77 | 2 | |
| β-strand | 82-84 | 3 | 6 |
| β-strand | 87-89 | 3 | 6 |
| α-helix | 91-99 | 9 | |
| β-strand | 109-111 | 3 | 7 |
| α-helix | 119-121 | 3 | |
| β-strand | 125-127 | 3 | 5 |
| α-helix | 130-132 | 3 | |
| β-strand | 133-135 | 3 | 7 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| MH1 domain of human Smad4 | A, B | protein | 135 | Homo sapiens | Q13485 (AlphaFold model) |
| DNA (5'-d(p*ap*cp*gp*gp*gp*cp*cp*gp*cp*gp*gp*cp*cp*cp*gp*t)-3') | E, F | DNA | 16 | Homo sapiens |
>5MF0_1 MH1 domain of human Smad4 (chains A, B) GAMGPTSNDACLSIVHSLMCHRQGGESETFAKRAIESLVKKLKEKKDELDSLITAITTNG AHPSKCVTIQRTLDGRLQVAGRKGFPHVIYARLWRWPDLHKNELKHVKYCQYAFDLKCDS VCVNPYHYERVVSPG
>5MF0_2 DNA (5'-D(P*AP*CP*GP*GP*GP*CP*CP*GP*CP*GP*GP*CP*CP*CP*GP*T)-3') (chains E, F) ACGGGCCGCGGCCCGT
| ID | Name | Formula | Copies |
|---|---|---|---|
| ZN | Zinc ion | Zn | 2 |
Water and common crystallization additives (CL) are not listed.
Structural basis for genome wide recognition of 5-bp GC motifs by SMAD transcription factors. Martin-Malpartida, P., Batet, M., Kaczmarska, Z. et al. Nat Commun (2017) 8:2070-2070. DOI 10.1038/s41467-017-02054-6 · PubMed
Other PDB entries of the same protein (UniProt Q13485 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 5MF0 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.