5MS5: Low-salt structure of RavZ LIR2-fused human LC3B

Low-salt structure of RavZ LIR2-fused human LC3B. Determined by X-ray diffraction at 1.53 Å resolution. Released 19 Apr 2017.

Method: X-ray diffraction
Resolution: 1.53 Å
Organisms: Legionella pneumophila, Homo sapiens
Chains: 2
Atoms: 2,334
Mol. weight: 32.41 kDa
Released: 19 Apr 2017

Explore 5MS5 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

5MS5 contains 13 α-helices and 14 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 6 helices, 7 β-strands

Element	Residues	Length	Sheet
α-helix	7-10	4
α-helix	13-26	14
β-strand	30-37	8	1
α-helix	38	1
β-strand	51-55	5	1
β-strand	59	1	2
α-helix	60-71	12
β-strand	80-83	4	1
β-strand	86	1	1
β-strand	94	1	2
α-helix	95-102	8
α-helix	108	1
β-strand	109-114	6	1

Chain B: 7 helices, 7 β-strands

Element	Residues	Length	Sheet
α-helix	-11--9	3
α-helix	-8--6	3
α-helix	7-10	4
α-helix	13-26	14
β-strand	30-37	8	3
β-strand	51-55	5	3
β-strand	59	1	4
α-helix	60-70	11
β-strand	80-83	4	3
β-strand	86-87	2	3
β-strand	94	1	4
α-helix	95-102	8
α-helix	108	1
β-strand	109-114	6	3

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
RavZ,Microtubule-associated proteins 1A/1B light chain 3B	A, B	protein	137	Legionella pneumophila, Homo sapiens	Q5ZUV9 (AlphaFold model), Q9GZQ8 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>5MS5_1 RavZ,Microtubule-associated proteins 1A/1B light chain 3B (chains A, B)
GHMGSDIDEFDLLEGDEGSPSEKTFKQRRTFEQRVEDVRLIREQHPTKIPVIIERYKGEK
QLPVLDKTKFLVPDHVNMSELIKIIRRRLQLNANQAFFLLVNGHSMVSVSTPISEVYESE
KDEDGFLYMVYASQETF

Primary citation

Elucidation of the anti-autophagy mechanism of the Legionella effector RavZ using semisynthetic LC3 proteins. Yang, A., Pantoom, S., Wu, Y.W. Elife (2017) 6. DOI 10.7554/eLife.23905 · PubMed

Other PDB entries of the same protein (UniProt Q5ZUV9 (AlphaFold model), which also has an AlphaFold model), best resolution first:

5XAD 1.88 Å, NLIR - LC3B fusion protein
5MS2 2.47 Å, Crystal structure of the Legionella pneumophila effector protein RavZ in complex with…
5HZY 2.55 Å, Crystal structure of the legionella pneumophila effector protein RavZ - P6322
5IO3 2.74 Å, Crystal structure of the legionella pneumophila effector protein RavZ - I422
5MS7 2.8 Å, Crystal structure of the legionella pneumophila effector protein RavZ_20-502
5IZV 2.81 Å, Crystal structure of the legionella pneumophila effector protein RavZ - F222
5MS8 2.85 Å, Crystal structure of the legionella pneumophila effector protein RavZ_1-487
5CQC 2.98 Å, Crystal structure of the legionella pneumophila effector protein RavZ

Browse structure collections

About this viewer

MolViewer shows 5MS5 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.