Structure of human Myosin 7b C-terminal MyTH4-FERM MF2 domain. Determined by X-ray diffraction at 2.44 Å resolution. Released 5 Jul 2017.
Explore 5MV7 in 3D Show helices and sheets RCSB PDB PDBe
5MV7 contains 29 α-helices and 16 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 1605-1609 | 5 | |
| α-helix | 1612-1618 | 7 | |
| β-strand | 1619 | 1 | 1 |
| α-helix | 1620-1622 | 3 | |
| α-helix | 1648-1649 | 2 | |
| β-strand | 1654 | 1 | 1 |
| α-helix | 1655-1658 | 4 | |
| α-helix | 1661-1663 | 3 | |
| α-helix | 1664-1678 | 15 | |
| α-helix | 1689-1702 | 14 | |
| α-helix | 1706-1717 | 12 | |
| α-helix | 1724-1737 | 14 | |
| α-helix | 1748-1756 | 9 | |
| α-helix | 1764-1777 | 14 | |
| α-helix | 1786-1793 | 8 | |
| β-strand | 1799-1805 | 7 | 2 |
| β-strand | 1809-1815 | 7 | 2 |
| β-strand | 1820 | 1 | 3 |
| α-helix | 1821-1832 | 12 | |
| β-strand | 1840-1846 | 7 | 2 |
| β-strand | 1849-1852 | 4 | 2 |
| α-helix | 1853-1854 | 2 | |
| β-strand | 1858 | 1 | 3 |
| α-helix | 1859-1873 | 15 | |
| α-helix | 1882-1885 | 4 | |
| β-strand | 1886-1892 | 7 | 2 |
| α-helix | 1904-1906 | 3 | |
| α-helix | 1907-1911 | 5 | |
| α-helix | 1912-1920 | 9 | |
| α-helix | 1928-1943 | 16 | |
| α-helix | 1949-1952 | 4 | |
| α-helix | 1957-1960 | 4 | |
| α-helix | 1966-1968 | 3 | |
| α-helix | 1971-1982 | 12 | |
| α-helix | 1983-1985 | 3 | |
| α-helix | 1990-2001 | 12 | |
| β-strand | 2010-2016 | 7 | 4 |
| β-strand | 2025-2031 | 7 | 4 |
| β-strand | 2034-2038 | 5 | 4 |
| β-strand | 2045-2049 | 5 | 4 |
| α-helix | 2051-2053 | 3 | |
| β-strand | 2056-2059 | 4 | 4 |
| β-strand | 2064-2067 | 4 | 4 |
| β-strand | 2076-2080 | 5 | 4 |
| α-helix | 2084-2095 | 12 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Unconventional myosin-VIIb | A | protein | 522 | Homo sapiens | Q6PIF6 (AlphaFold model) |
>5MV7_1 Unconventional myosin-VIIb (chains A) HHHHHHSSGHKEKLHTLEEFSYEFFRAPEKDAVSMAVLPLARARGHLWAYSCEPLRQPLL KRVHANVDLWDIACQIFVAILRYMGDYPSRQAWPTLELTDQIFTLALQHPALQDEVYCQI LKQLTHNSNRHSEERGWQLLWLCTGLFPPSKGLLPHAQKFIDTRRGKLLAPDCSRRIQKV LRTGPRKQPPHQVEVEAAEQNVSRICHKIYFPNDTSEMLEVVANTRVRDVCDSIATRLQL ASWEGCSLFIKISDKVISQKEGDFFFDSLREVSDWVKKNKPQKEGAPVTLPYQVYFMRKL WLNISPGKDVNADTILHYHQELPKYLRGFHKCSREDAIHLAGLIYKAQFNNDRSQLASVP KILRELVPENLTRLMSSEEWKKSILLAYDKHKDKTVEEAKVAFLKWICRWPTFGSAFFEV KQTSEPSYPDVILIAINRHGVLLIHPKTKDLLTTYPFTKISSWSSGSTYFHMALGSLGRG SRLLCETSLGYKMDDLLTSYVQQLLSAMNKQRGSKAPALAST
| ID | Name | Formula | Copies |
|---|---|---|---|
| TAM | Tris(hydroxyethyl)aminomethane | C7 H17 N O3 | 2 |
Water and common crystallization additives (SO4) are not listed.
Myosin 7 and its adaptors link cadherins to actin. Yu, I.M., Planelles-Herrero, V.J., Sourigues, Y. et al. Nat Commun (2017) 8:15864-15864. DOI 10.1038/ncomms15864 · PubMed
Other PDB entries of the same protein (UniProt Q6PIF6 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 5MV7 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.