5XBF: Myo7b C-terminal MyTH4-FERM

Crystal Structure of Myo7b C-terminal MyTH4-FERM in complex with USH1C PDZ3. Determined by X-ray diffraction at 1.8 Å resolution. Released 17 May 2017.

Method: X-ray diffraction
Resolution: 1.8 Å
Organism: Homo sapiens
Chains: 2
Atoms: 4,913
Mol. weight: 73.77 kDa
Ligands: MLT
Released: 17 May 2017

Explore 5XBF in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

5XBF contains 35 α-helices and 23 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 30 helices, 16 β-strands

Element	Residues	Length	Sheet
α-helix	1612-1618	7
β-strand	1619	1	1
α-helix	1620-1621	2
α-helix	1648-1649	2
β-strand	1654	1	1
α-helix	1655-1658	4
α-helix	1661-1663	3
α-helix	1664-1678	15
α-helix	1689-1702	14
α-helix	1705-1717	13
α-helix	1724-1738	15
α-helix	1742-1744	3
α-helix	1748-1756	9
α-helix	1764-1777	14
α-helix	1786-1793	8
β-strand	1799-1805	7	2
β-strand	1809-1815	7	2
β-strand	1820	1	3
α-helix	1821-1832	12
β-strand	1840-1846	7	2
β-strand	1849-1852	4	2
α-helix	1853-1854	2
β-strand	1858	1	3
α-helix	1859-1873	15
α-helix	1883-1885	3
β-strand	1886-1892	7	2
α-helix	1904-1906	3
α-helix	1907-1911	5
α-helix	1912-1920	9
α-helix	1928-1943	16
α-helix	1947-1951	5
α-helix	1953-1956	4
α-helix	1957-1959	3
α-helix	1966-1968	3
α-helix	1971-1982	12
α-helix	1983-1985	3
α-helix	1990-2001	12
β-strand	2010-2016	7	4
β-strand	2025-2031	7	4
β-strand	2034-2038	5	4
β-strand	2045-2049	5	4
α-helix	2051-2053	3
β-strand	2054-2059	6	4
β-strand	2063-2068	6	4
β-strand	2075-2080	6	4
α-helix	2084-2099	16

Chain B: 5 helices, 7 β-strands

Element	Residues	Length	Sheet
α-helix	439-441	3
α-helix	445-448	4
β-strand	453-459	7	5
β-strand	466-471	6	5
β-strand	478-484	7	5
α-helix	489-493	5
β-strand	501-505	5	5
β-strand	508-509	2	5
β-strand	514	1	5
α-helix	515-527	13
β-strand	532-538	7	5
α-helix	539-543	5

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Unconventional myosin-VIIb	A	protein	516	Homo sapiens	Q6PIF6 (AlphaFold model)
Harmonin	B	protein	125	Homo sapiens	Q9Y6N9 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>5XBF_1 Unconventional myosin-VIIb (chains A)
EEPPKEKLHTLEEFSYEFFRAPEKDMVSMAVLPLARARGHLWAYSCEPLRQPLLKRVHAN
VDLWDIACQIFVAILRYMGDYPSRQAWPTLELTDQIFTLALQHPALQDEVYCQILKQLTH
NSNRHSEERGWQLLWLCTGLFPPSKGLLPHAQKFIDTRRGKLLAPDCSRRIQKVLRTGPR
KQPPHQVEVEAAEQNVSRICHKIYFPNDTSEMLEVVANTRVRDVCDSIATRLQLASWEGC
SLFIKISDKVISQKEGDFFFDSLREVSDWVKKNKPQKEGAPVTLPYQVYFMRKLWLNISP
GKDVNADTILHYHQELPKYLRGFHKCSREDAIHLAGLIYKAQFNNDRSQLASVPKILREL
VPENLTRLMSSEEWKKSILLAYDKHKDKTVEEAKVAFLKWICRWPTFGSAFFEVKQTSEP
SYPDVILIAINRHGVLLIHPKTKDLLTTYPFTKISSWSSGSTYFHMALGSLGRGSRLLCE
TSLGYKMDDLLTSYVQQLLSAMNKQRGSKAPALAST

Sequence of entity 2 (B), FASTA

>5XBF_2 Harmonin (chains B)
QDFRKYEEGFDPYSMFTPEQIMGKDVRLLRIKKEGSLDLALEGGVDSPIGKVVVSAVYER
GAAERHGGIVKGDEIMAINGKIVTDYTLAEAEAALQKAWNQGGDWIDLVVAVCPPKEYDD
ELTFF

Ligands and cofactors

ID	Name	Formula	Copies
MLT	D-malate	C4 H6 O5	1

Water and common crystallization additives (GOL, ACT) are not listed.

Primary citation

Structure of Myo7b/USH1C complex suggests a general PDZ domain binding mode by MyTH4-FERM myosins. Li, J., He, Y., Weck, M.L. et al. Proc Natl Acad Sci U S A (2017) 114:E3776-E3785. DOI 10.1073/pnas.1702251114 · PubMed

Other PDB entries of the same protein (UniProt Q6PIF6 (AlphaFold model), which also has an AlphaFold model), best resolution first:

5MV8 1.88 Å, Structure of human Myosin 7b C-terminal MyTH4-FERM domain in complex with harmonin-a…
5MV7 2.44 Å, Structure of human Myosin 7b C-terminal MyTH4-FERM MF2 domain

Browse structure collections

About this viewer

MolViewer shows 5XBF directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.