5MZ7: Disks large homolog 4

Crystal Structure of the third PDZ domain from the synaptic protein PSD-95 with incorporated Azidohomoalanine. Determined by X-ray diffraction at 1.53 Å resolution. Released 4 Oct 2017.

Method: X-ray diffraction
Resolution: 1.53 Å
Organism: Rattus norvegicus
Chains: 4
Atoms: 3,586
Mol. weight: 43.21 kDa
Released: 4 Oct 2017

Explore 5MZ7 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

5MZ7 contains 15 α-helices and 34 β-strands across 4 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 3 helices, 8 β-strands

Element	Residues	Length	Sheet
β-strand	312-317	6	1
β-strand	325-328	4	1
β-strand	337-341	5	1
β-strand	342	1	2
α-helix	346-350	5
β-strand	357-362	6	1
β-strand	365-366	2	1
α-helix	372-380	9
β-strand	385-392	8	1
α-helix	394-398	5
β-strand	401	1	3

Chain B: 4 helices, 10 β-strands

Element	Residues	Length	Sheet
α-helix	304-306	3
β-strand	312-317	6	4
β-strand	319	1	5
β-strand	322	1	5
β-strand	325-328	4	4
β-strand	337-341	5	4
β-strand	342	1	3
α-helix	346-350	5
β-strand	357-362	6	4
β-strand	365-366	2	4
α-helix	372-380	9
β-strand	385-392	8	4
α-helix	394-397	4
β-strand	401	1	2

Chain C: 4 helices, 8 β-strands

Element	Residues	Length	Sheet
β-strand	312-317	6	6
β-strand	319	1	7
β-strand	322	1	7
β-strand	325-329	5	6
α-helix	331-333	3
β-strand	336-341	6	6
α-helix	346-350	5
β-strand	357-362	6	6
β-strand	365-366	2	6
α-helix	372-381	10
β-strand	385-392	8	6
α-helix	394-398	5

Chain D: 4 helices, 8 β-strands

Element	Residues	Length	Sheet
β-strand	312-317	6	8
β-strand	319	1	9
β-strand	322	1	9
β-strand	325-329	5	8
β-strand	336-341	6	8
α-helix	346-350	5
β-strand	357-362	6	8
β-strand	365-366	2	8
α-helix	372-380	9
β-strand	385-392	8	8
α-helix	394-397	4
α-helix	398-400	3

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Disks large homolog 4	A, B, C, D	protein	101	Rattus norvegicus	P31016 (AlphaFold model)

Sequence of entity 1 (A, B, C, D), FASTA

>5MZ7_1 Disks large homolog 4 (chains A, B, C, D)
GGEEDIPREPRRIVIHRGSTGLGFNIIGGEDGEGIFISFALAGGPADLSGELRKGDQILS
VNGVDLRNASHEQAAIALKNAGQTVTIIAQYKPEEYSRFEA

Primary citation

Impact of Azidohomoalanine Incorporation on Protein Structure and Ligand Binding. Lehner, F., Kudlinzki, D., Richter, C. et al. Chembiochem (2017) 18:2340-2350. DOI 10.1002/cbic.201700437 · PubMed

Other PDB entries of the same protein (UniProt P31016 (AlphaFold model), which also has an AlphaFold model), best resolution first:

5HEY 1.5 Å, The third PDZ domain from the synaptic protein PSD-95 (G330T mutant) in complex with a…
1TP5 1.54 Å, Crystal structure of PDZ3 domain of PSD-95 protein complexed with a peptide ligand KKETWV
5HFD 1.6 Å, The third PDZ domain from the synaptic protein PSD-95 (G330T, H372A double mutant)
5HFB 1.62 Å, The third PDZ domain from the synaptic protein PSD-95 (H372A mutant) in complex with a…
5HEB 1.65 Å, The third PDZ domain from the synaptic protein PSD-95 in complex with a C-terminal…
5HED 1.7 Å, The third PDZ domain from the synaptic protein PSD-95 in complex with a mutant…
5HF1 1.75 Å, The third PDZ domain from the synaptic protein PSD-95 (G330T mutant) in complex with a…
5HFF 1.75 Å, The third PDZ domain from the synaptic protein PSD-95 (G330T, H372A double mutant) in…
5HF4 1.75 Å, The third PDZ domain from the synaptic protein PSD-95 (H372A mutant)
1KJW 1.8 Å, SH3-Guanylate Kinase Module from PSD-95
5HFE 1.8 Å, The third PDZ domain from the synaptic protein PSD-95 (G330T, H372A double mutant) in…
7CQF 1.8 Å, Crystal structure of PSD-95 PDZ3 fused with ADAM22 C-terminal peptide

Browse structure collections

About this viewer

MolViewer shows 5MZ7 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.