Cardiac muscle myosin motor domain in the pre-powerstroke state. Determined by X-ray diffraction at 3.1 Å resolution. Released 9 Aug 2017.
Explore 5N6A in 3D Show helices and sheets RCSB PDB PDBe
5N6A contains 28 α-helices and 29 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 36-40 | 5 | 1 |
| β-strand | 46-50 | 5 | 1 |
| β-strand | 51-54 | 4 | 2 |
| β-strand | 58-60 | 3 | 2 |
| β-strand | 69 | 1 | 2 |
| β-strand | 78-79 | 2 | 1 |
| α-helix | 80 | 1 | |
| β-strand | 89 | 1 | 3 |
| α-helix | 90-92 | 3 | |
| α-helix | 98-109 | 12 | |
| β-strand | 115-117 | 3 | 3 |
| β-strand | 122-125 | 4 | 3 |
| α-helix | 136-142 | 7 | |
| α-helix | 154-167 | 14 | |
| β-strand | 172-178 | 7 | 3 |
| β-strand | 179 | 1 | 4 |
| α-helix | 184-196 | 13 | |
| α-helix | 219-223 | 5 | |
| α-helix | 224-226 | 3 | |
| β-strand | 232-233 | 2 | 5 |
| β-strand | 241-242 | 2 | 5 |
| β-strand | 246-252 | 7 | 3 |
| β-strand | 258-265 | 8 | 3 |
| α-helix | 270-272 | 3 | |
| β-strand | 283 | 1 | 5 |
| α-helix | 284-291 | 8 | |
| α-helix | 325-338 | 14 | |
| α-helix | 343-359 | 17 | |
| β-strand | 365-368 | 4 | 6 |
| β-strand | 372-374 | 3 | 6 |
| α-helix | 383-386 | 4 | |
| α-helix | 393-400 | 8 | |
| β-strand | 403-406 | 4 | 7 |
| β-strand | 409-412 | 4 | 7 |
| α-helix | 413 | 1 | |
| α-helix | 417-447 | 31 | |
| β-strand | 456-461 | 6 | 3 |
| β-strand | 465 | 1 | 4 |
| α-helix | 473-493 | 21 | |
| α-helix | 496-504 | 9 | |
| α-helix | 518-524 | 7 | |
| α-helix | 530-539 | 10 | |
| α-helix | 545-556 | 12 | |
| β-strand | 563-564 | 2 | 8 |
| β-strand | 577-579 | 3 | 8 |
| β-strand | 586-588 | 3 | 8 |
| α-helix | 594-597 | 4 | |
| α-helix | 603-610 | 8 | |
| α-helix | 615-622 | 8 | |
| α-helix | 647-662 | 16 | |
| β-strand | 666-673 | 8 | 3 |
| α-helix | 686-689 | 4 | |
| α-helix | 692-696 | 5 | |
| β-strand | 711-712 | 2 | 9 |
| β-strand | 756-757 | 2 | 9 |
| β-strand | 764-765 | 2 | 9 |
| α-helix | 767-774 | 8 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Myosin-7 | A | protein | 828 | Bos taurus | Q9BE39 (AlphaFold model) |
>5N6A_1 Myosin-7 (chains A) MVDAEMAAFGEAAPYLRKSEKERLEAQTRPFDLKKDVFVPDDKEEFVKATILSREGGKVT AETEHGKTVTVKEDQVLQQNPPKFDKIEDMAMLTFLHEPAVLYNLKERYASWMIYTYSGL FCVTINPYKWLPVYNAEVVAAYRGKKRSEAPPHIFSISDNAYQYMLTDRENQSILITGES GAGKTVNTKRVIQYFAVIAAIGDRSKKEQATGKGTLEDQIIQANPALEAFGNAKTVRNDN SSRFGKFIRIHFGATGKLASADIETYLLEKSRVIFQLKAERDYHIFYQILSNKKPELLDM LLITNNPYDYAFISQGETTVASIDDAEELMATDNAFDVLGFTTEEKNSMYKLTGAIMHFG NMKFKLKQREEQAEPDGTEEADKSAYLMGLNSADLLKGLCHPRVKVGNEYVTKGQNVQQV VYAKGALAKAVYERMFNWMVTRINATLETKQPRQYFIGVLDIAGFEIFDFNSFEQLCINF TNEKLQQFFNHHMFVLEQEEYKKEGIEWEFIDFGMDLQACIDLIEKPMGIMSILEEECMF PKATDMTFKAKLFDNHLGKSSNFQKPRNIKGKPEAHFSLIHYAGTVDYNIIGWLQKNKDP LNETVVDLYKKSSLKMLSSLFANYAGFDTPIEKGKGKAKKGSSFQTVSALHRENLNKLMT NLRSTHPHFVRCIIPNETKSPGVIDNPLVMHQLRCNGVLEGIRICRKGFPNRILYGDFRQ RYRILNPAAIPEGQFIDSRKGAEKLLGSLDIDHNQYKFGHTKVFFKAGLLGLLEEMRDER LSRIITRIQAQSRGVLSRMEFKKLLERRDSLLIIQWNIRAFMGVKNWP
| ID | Name | Formula | Copies |
|---|---|---|---|
| ADP | Adenosine-5'-diphosphate | C10 H15 N5 O10 P2 | 1 |
| PO4 | Phosphate ion | O4 P | 1 |
| MG | Magnesium ion | Mg | 1 |
Water and common crystallization additives (GOL) are not listed.
Mechanistic and structural basis for activation of cardiac myosin force production by omecamtiv mecarbil. Planelles-Herrero, V.J., Hartman, J.J., Robert-Paganin, J. et al. Nat Commun (2017) 8:190-190. DOI 10.1038/s41467-017-00176-5 · PubMed
Other PDB entries of the same protein (UniProt Q9BE39 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 5N6A directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.