5N95: 3D polymerase

Tetragonal structure of mutant V173I of 3D polymerase from Foot-and-Mouth Disease Virus. Determined by X-ray diffraction at 2.6 Å resolution. Released 10 May 2017.

Method: X-ray diffraction
Resolution: 2.6 Å
Organism: Foot-and-mouth disease virus
Chains: 1
Atoms: 3,824
Mol. weight: 54.38 kDa
Ligands: 3PO
Released: 10 May 2017

Explore 5N95 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

5N95 contains 27 α-helices and 24 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 27 helices, 24 β-strands

Element	Residues	Length	Sheet
β-strand	2-13	12	1
β-strand	21-23	3	2
α-helix	25-30	6
β-strand	34-36	3	3
α-helix	47	1
α-helix	52-57	6
α-helix	68-89	22
α-helix	94-97	4
α-helix	98-103	6
β-strand	105	1	4
β-strand	108	1	4
α-helix	109-112	4
α-helix	121-124	4
α-helix	128-131	4
β-strand	132-133	2	5
β-strand	138-139	2	5
α-helix	141-151	11
β-strand	159-163	5	1
β-strand	167-169	3	3
α-helix	170-174	5
β-strand	180-183	4	1
α-helix	186-205	20
β-strand	208	1	6
β-strand	213	1	6
α-helix	219-230	12
β-strand	235-241	7	7
α-helix	250-260	11
α-helix	263-265	3
α-helix	270-276	7
β-strand	280-293	14	1
α-helix	296-297	2
α-helix	303-322	20
α-helix	328-330	3
β-strand	332-336	5	7
β-strand	339-344	6	7
α-helix	354-358	5
β-strand	364-366	3	7
β-strand	385	1	8
β-strand	388	1	8
β-strand	389-392	4	9
β-strand	399-402	4	9
α-helix	405-413	9
β-strand	414-416	3	2
α-helix	420-431	12
α-helix	432-434	3
α-helix	436-442	7
β-strand	447	1	10
β-strand	450	1	10
α-helix	452-454	3
α-helix	455-466	12
α-helix	468-473	6

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
3D polymerase	A	protein	481	Foot-and-mouth disease virus	P03311

Sequence of entity 1 (A), FASTA

>5N95_1 3D polymerase (chains A)
GLIVDTRDVEERVHVMRKTKLAPTVAHGVFNPEFGPAALSNKDPRLNEGVVLDEVIFSKH
KGDTKMSAEDKALFRRCAADYASRLHSVLGTANAPLSIYEAIKGVDGLDAMEPDTAPGLP
WALQGKRRGALIDFENGTVGPEVEAALKLMEKREYKFACQTFLKDEIRPMEKIRAGKTRI
VDVLPVEHILYTRMMIGRFCAQMHSNNGPQIGSAVGCNPDVDWQRFGTHFAQYRNVWDVD
YSAFDANHCSDAMNIMFEEVFRTEFGFHPNAEWILKTLVNTEHAYENKRITVEGGMPSGC
SATSIINTILNNIYVLYALRRHYEGVELDTYTMISYGDDIVVASDYDLDFEALKPHFKSL
GQTITPADKSDKGFVLGHSITDVTFLKRHFHMDYGTGFYKPVMASKTLEAILSFARRGTI
QEKLISVAGLAVHSGPDEYRRLFEPFQGLFEIPSYRSLYLRWVNAVCGDAAAALEHHHHH
H

Ligands and cofactors

ID	Name	Formula	Copies
3PO	Triphosphate	H5 O10 P3	1

Primary citation

Molecular and Functional Bases of Selection against a Mutation Bias in an RNA Virus. de la Higuera, I., Ferrer-Orta, C., de Avila, A.I. et al. Genome Biol Evol (2017) 9:1212-1228. DOI 10.1093/gbe/evx075 · PubMed

Other PDB entries of the same protein (UniProt P03311), best resolution first:

8C1N 1.7 Å, FMDV 3D polymerase in complex with 3B1 protein solved in P212121 space group
4WYW 1.8 Å, Mutant K20E of 3D polymerase from Foot-and-Mouth Disease Virus
6KWL 1.8 Å, Crystal structure of pSLA-1*0401(R156A) complex with FMDV-derived epitope MTAHITVPY
8C2P 1.85 Å, FMDV 3D polymerase in complex with 3B3
4WYL 2.0 Å, Mutant K18E of 3D polymerase from Foot-and-Moth Disease Virus
6GVY 2.2 Å, Mutant M16A of RNA dependent RNA polymerase 3D from Foot-and-Mouth disease Virus…
6S2L 2.3 Å, FMDV 3D polymerase crystallized in presence of (F)uridylylated VPg peptide
6GVV 2.35 Å, Mutant M16A of RNA dependent RNA polymerase 3D from Foot-and-Mouth disease Virus
5N8X 2.4 Å, Trigonal structure of mutant V173I of 3D polymerase from Foot-and-Mouth Disease Virus
6KWK 2.5 Å, Crystal structure of pSLA-1*0401 complex with FMDV-derived epitope MTAHITVPY
9I3H 2.5 Å, CP of RHDV mutant - N15
4WZM 2.52 Å, Mutant K18E of RNA dependent RNA polymerase from Foot-and-Mouth Disease Virus complexed…

Browse structure collections

About this viewer

MolViewer shows 5N95 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.