8C2P: FMDV 3D polymerase

FMDV 3D polymerase in complex with 3B3. Determined by X-ray diffraction at 1.85 Å resolution. Released 26 Apr 2023.

Method: X-ray diffraction
Resolution: 1.85 Å
Organism: Foot-and-mouth disease virus
Chains: 2
Atoms: 3,755
Mol. weight: 56.62 kDa
Released: 26 Apr 2023

Explore 8C2P in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

8C2P contains 26 α-helices and 24 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 26 helices, 23 β-strands

Element	Residues	Length	Sheet
β-strand	2-13	12	1
β-strand	22-23	2	2
α-helix	24	1
α-helix	25-30	6
β-strand	35-36	2	3
α-helix	37-38	2
α-helix	47	1
α-helix	52-55	4
α-helix	64-67	4
α-helix	68-89	22
α-helix	94-97	4
α-helix	98-103	6
β-strand	105	1	4
β-strand	108	1	4
α-helix	109-112	4
α-helix	128-130	3
β-strand	132-133	2	5
β-strand	138-139	2	5
α-helix	141-151	11
β-strand	159-163	5	1
β-strand	167-168	2	3
α-helix	170-174	5
β-strand	180-183	4	1
α-helix	186-205	20
β-strand	208	1	6
β-strand	213	1	6
α-helix	219-230	12
β-strand	235-238	4	6
β-strand	239-241	3	7
α-helix	250-260	11
α-helix	263-265	3
α-helix	270-276	7
β-strand	280-293	14	1
α-helix	303-322	20
β-strand	324	1	8
β-strand	332-336	5	6
β-strand	339-344	6	6
α-helix	350-358	9
β-strand	364-366	3	7
β-strand	385	1	9
β-strand	388-393	6	9
β-strand	398-403	6	9
α-helix	405-412	8
β-strand	414-415	2	2
α-helix	420-431	12
α-helix	432-434	3
α-helix	436-443	8
α-helix	444-446	3
α-helix	455-466	12

Chain B: 0 helices, 1 β-strand

Element	Residues	Length	Sheet
β-strand	7	1	8

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
RNA-directed RNA polymerase 3D-POL	A	protein	480	Foot-and-mouth disease virus	P03311
Protein 3B-3	B	protein	24	Foot-and-mouth disease virus	P03311

Sequence of entity 1 (A), FASTA

>8C2P_1 RNA-directed RNA polymerase 3D-POL (chains A)
GLIVDTRDVEERVHVMRKTKLAPTVAHGVFNPEFGPAALSNKDPRLNEGVVLDEVIFSKH
KGDTKMSAEDKALFRRCAADYASRLHSVLGTANAPLSIYEAIKGVDGLDAMEPDTAPGLP
WALQGKRRGALIDFENGTVGPEVEAALKLMEKREYKFACQTFLKDEIRPMEKVRAGKTRI
VDVLPVEHILYTRMMIGRFCAQMHSNNGPQIGSAVGCNPDVDWQRFGTHFAQYRNVWDVD
YSAFDANHCSDAMNIMFEEVFRTEFGFHPNAEWILKTLVNTEHAYENKRITVEGGMPSGC
SATSIINTILNNIYVLYALRRHYEGVELDTYTMISYGDDIVVASDYDLDFEALKPHFKSL
GQTITPADKSDKGFVLGHSITDVTFLKRHFHMDYGTGFYKPVMASKTLEAILSFARRGTI
QEKLISVAGLAVHSGPDEYRRLFEPFQGLFEIPSYRSLYLRWVNAVCGDAAALEHHHHHH

Sequence of entity 2 (B), FASTA

>8C2P_2 Protein 3B-3 (chains B)
GPYEGPVKKPVALKVKAKNLIVTE

Primary citation

Dual role of the foot-and-mouth disease virus 3B1 protein in the replication complex: As protein primer and as an essential component to recruit 3Dpol to membranes. Ferrer-Orta, C., Ferrero, D.S., Verdaguer, N. PLoS Pathog (2023) 19:e1011373-e1011373. DOI 10.1371/journal.ppat.1011373 · PubMed

Other PDB entries of the same protein (UniProt P03311), best resolution first:

8C1N 1.7 Å, FMDV 3D polymerase in complex with 3B1 protein solved in P212121 space group
4WYW 1.8 Å, Mutant K20E of 3D polymerase from Foot-and-Mouth Disease Virus
6KWL 1.8 Å, Crystal structure of pSLA-1*0401(R156A) complex with FMDV-derived epitope MTAHITVPY
4WYL 2.0 Å, Mutant K18E of 3D polymerase from Foot-and-Moth Disease Virus
6GVY 2.2 Å, Mutant M16A of RNA dependent RNA polymerase 3D from Foot-and-Mouth disease Virus…
6S2L 2.3 Å, FMDV 3D polymerase crystallized in presence of (F)uridylylated VPg peptide
6GVV 2.35 Å, Mutant M16A of RNA dependent RNA polymerase 3D from Foot-and-Mouth disease Virus
5N8X 2.4 Å, Trigonal structure of mutant V173I of 3D polymerase from Foot-and-Mouth Disease Virus
6KWK 2.5 Å, Crystal structure of pSLA-1*0401 complex with FMDV-derived epitope MTAHITVPY
9I3H 2.5 Å, CP of RHDV mutant - N15
4WZM 2.52 Å, Mutant K18E of RNA dependent RNA polymerase from Foot-and-Mouth Disease Virus complexed…
5N95 2.6 Å, Tetragonal structure of mutant V173I of 3D polymerase from Foot-and-Mouth Disease Virus

Browse structure collections

About this viewer

MolViewer shows 8C2P directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.