NMR structure of TLR4 transmembrane domain (624-670) in DMPG/DHPC bicelles. Determined by solution NMR. Released 6 Sept 2017.
Explore 5NAM in 3D Show helices and sheets RCSB PDB PDBe
5NAM contains 1 α-helix and 0 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 8-40 | 33 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Toll-like receptor 4 | A | protein | 48 | Homo sapiens | O00206 (AlphaFold model) |
>5NAM_1 Toll-like receptor 4 (chains A) MNITSQMNKTIIGVSVLSVLVVSVVAVLVYKFYFHLMLLAGCIKYGRG
Spatial structure of TLR4 transmembrane domain in bicelles provides the insight into the receptor activation mechanism. Mineev, K.S., Goncharuk, S.A., Goncharuk, M.V. et al. Sci Rep (2017) 7:6864-6864. DOI 10.1038/s41598-017-07250-4 · PubMed
Other PDB entries of the same protein (UniProt O00206 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 5NAM directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.