5NAM: Toll-like receptor 4

NMR structure of TLR4 transmembrane domain (624-670) in DMPG/DHPC bicelles. Determined by solution NMR. Released 6 Sept 2017.

Method: Solution NMR
Organism: Homo sapiens
Chains: 1
Atoms: 368
Mol. weight: 5.28 kDa
Released: 6 Sept 2017

Explore 5NAM in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

5NAM contains 1 α-helix and 0 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 1 helix, 0 β-strands

Element	Residues	Length	Sheet
α-helix	8-40	33

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Toll-like receptor 4	A	protein	48	Homo sapiens	O00206 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>5NAM_1 Toll-like receptor 4 (chains A)
MNITSQMNKTIIGVSVLSVLVVSVVAVLVYKFYFHLMLLAGCIKYGRG

Primary citation

Spatial structure of TLR4 transmembrane domain in bicelles provides the insight into the receptor activation mechanism. Mineev, K.S., Goncharuk, S.A., Goncharuk, M.V. et al. Sci Rep (2017) 7:6864-6864. DOI 10.1038/s41598-017-07250-4 · PubMed

Other PDB entries of the same protein (UniProt O00206 (AlphaFold model), which also has an AlphaFold model), best resolution first:

2Z62 1.7 Å, Crystal structure of the TV3 hybrid of human TLR4 and hagfish VLRB.61
2Z66 1.9 Å, Crystal structure of the VT3 hybrid of human TLR4 and hagfish VLRB.61
2Z63 2.0 Å, Crystal structure of the TV8 hybrid of human TLR4 and hagfish VLRB.61
8WO1 2.24 Å, Cryo-EM Structure of Human TLR4/MD-2/DLAM5 Complex
3UL7 2.37 Å, Crystal structure of the TV3 mutant F63W
4G8A 2.4 Å, Crystal structure of human TLR4 polymorphic variant D299G and T399I in complex with MD-2…
3UL9 2.45 Å, structure of the TV3 mutant M41E
3UL8 2.5 Å, Crystal structure of the TV3 mutant V134L
2Z65 2.7 Å, Crystal structure of the human TLR4 TV3 hybrid-MD-2-Eritoran complex
9J03 2.7 Å, Cyro-EM Structure of Human TLR4/MD-2/DLAM1 Complex
8WTA 2.9 Å, Cryo-EM Structure of Human TLR4/MD-2/DLAM3 Complex
3FXI 3.1 Å, Crystal structure of the human TLR4-human MD-2-E.coli LPS Ra complex

Browse structure collections

About this viewer

MolViewer shows 5NAM directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.