Flavivirus NS5 domain. Determined by X-ray diffraction at 2.0 Å resolution. Released 24 Jan 2018.
Explore 5NJV in 3D Show helices and sheets RCSB PDB PDBe
5NJV contains 54 α-helices and 42 β-strands across 4 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 8-18 | 11 | |
| α-helix | 21-27 | 7 | |
| β-strand | 33-35 | 3 | 1 |
| α-helix | 38-46 | 9 | |
| α-helix | 58-67 | 10 | |
| β-strand | 75-80 | 6 | 2 |
| α-helix | 86-92 | 7 | |
| β-strand | 97-103 | 7 | 2 |
| α-helix | 121-123 | 3 | |
| β-strand | 124-127 | 4 | 2 |
| α-helix | 132-134 | 3 | |
| α-helix | 136-137 | 2 | |
| β-strand | 142-145 | 4 | 2 |
| α-helix | 154-172 | 19 | |
| β-strand | 178-183 | 6 | 2 |
| α-helix | 189-202 | 14 | |
| β-strand | 205-207 | 3 | 2 |
| β-strand | 219-222 | 4 | 2 |
| α-helix | 229-245 | 17 | |
| α-helix | 247-251 | 5 | |
| β-strand | 252-254 | 3 | 1 |
| α-helix | 255-257 | 3 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 8-18 | 11 | |
| α-helix | 21-29 | 9 | |
| β-strand | 33-35 | 3 | 3 |
| α-helix | 38-46 | 9 | |
| α-helix | 58-66 | 9 | |
| β-strand | 75-80 | 6 | 4 |
| α-helix | 86-92 | 7 | |
| β-strand | 97-103 | 7 | 4 |
| α-helix | 111-114 | 4 | |
| α-helix | 121-123 | 3 | |
| β-strand | 124-127 | 4 | 4 |
| α-helix | 136-137 | 2 | |
| β-strand | 142-145 | 4 | 4 |
| α-helix | 154-172 | 19 | |
| β-strand | 178-183 | 6 | 4 |
| α-helix | 189-202 | 14 | |
| β-strand | 205-207 | 3 | 4 |
| β-strand | 219-222 | 4 | 4 |
| α-helix | 229-245 | 17 | |
| α-helix | 247-248 | 2 | |
| α-helix | 250-251 | 2 | |
| β-strand | 252-254 | 3 | 3 |
| α-helix | 255-257 | 3 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 8-16 | 9 | |
| β-strand | 20 | 1 | 5 |
| α-helix | 21-28 | 8 | |
| β-strand | 33-35 | 3 | 6 |
| α-helix | 38-41 | 4 | |
| β-strand | 53 | 1 | 7 |
| α-helix | 58-67 | 10 | |
| β-strand | 75-80 | 6 | 8 |
| α-helix | 86-91 | 6 | |
| β-strand | 97-103 | 7 | 8 |
| α-helix | 121-123 | 3 | |
| β-strand | 124-127 | 4 | 8 |
| α-helix | 132-134 | 3 | |
| α-helix | 136-137 | 2 | |
| β-strand | 142-145 | 4 | 8 |
| α-helix | 154-172 | 19 | |
| β-strand | 178-183 | 6 | 8 |
| α-helix | 189-202 | 14 | |
| β-strand | 205-207 | 3 | 8 |
| β-strand | 219-222 | 4 | 8 |
| α-helix | 229-242 | 14 | |
| α-helix | 249-251 | 3 | |
| β-strand | 252-254 | 3 | 6 |
| α-helix | 255-257 | 3 | |
| β-strand | 258 | 1 | 7 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 8-18 | 11 | |
| β-strand | 20 | 1 | 5 |
| α-helix | 21-27 | 7 | |
| β-strand | 33-36 | 4 | 9 |
| α-helix | 38-41 | 4 | |
| β-strand | 53 | 1 | 10 |
| α-helix | 58-67 | 10 | |
| β-strand | 75-80 | 6 | 11 |
| α-helix | 86-91 | 6 | |
| β-strand | 97-103 | 7 | 11 |
| α-helix | 111-114 | 4 | |
| α-helix | 121-123 | 3 | |
| β-strand | 124-127 | 4 | 11 |
| α-helix | 132-134 | 3 | |
| α-helix | 136-137 | 2 | |
| β-strand | 142-145 | 4 | 11 |
| α-helix | 154-172 | 19 | |
| β-strand | 178-183 | 6 | 11 |
| α-helix | 189-202 | 14 | |
| β-strand | 205-207 | 3 | 11 |
| β-strand | 219-222 | 4 | 11 |
| α-helix | 229-245 | 17 | |
| α-helix | 247-251 | 5 | |
| β-strand | 252-255 | 4 | 9 |
| α-helix | 256-257 | 2 | |
| β-strand | 258 | 1 | 10 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| NS5 | A, B, C, D | protein | 262 | Zika virus (strain Mr 766) | A0A024B7W1 (AlphaFold model) |
>5NJV_1 NS5 (chains A, B, C, D) TGETLGEKWKARLNQMSALEFYSYKKSGITEVCREEARRALKDGVATGGHAVSRGSAKLR WLVDRGYLQPYGKVIDLGCGRGGWSYYAATIRKVQEVKGYTKGGPGHEEPVLVQSYGWNI VRLKSGVDVFHMAAEPCDTLLCDIGESSSSPEVEEARTLRVLSMVGDWLEKRPGAFCIKV LCPYTSTMMETLERLQRRYGGGLVRVPLSRNSTHEMYWVSGAKSNTIKSVSTTSQLLLGR MDGPRRPVKYEEDVNLGSGTRA
| ID | Name | Formula | Copies |
|---|---|---|---|
| SAM | S-adenosylmethionine | C15 H22 N6 O5 S | 4 |
Water and common crystallization additives (CL) are not listed.
The structure of the binary methyltransferase-SAH complex from Zika virus reveals a novel conformation for the mechanism of mRNA capping. Chatrin, C., Talapatra, S.K., Canard, B. et al. Oncotarget (2018) 9:3160-3171. DOI 10.18632/oncotarget.23223 · PubMed
Other PDB entries of the same protein (UniProt A0A024B7W1 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 5NJV directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.