5NP2: Abl1 SH3 pTyr89/134

Abl1 SH3 pTyr89/134. Determined by X-ray diffraction at 1.6 Å resolution. Released 16 May 2018.

Method: X-ray diffraction
Resolution: 1.6 Å
Organism: Homo sapiens
Chains: 2
Atoms: 1,048
Mol. weight: 13.82 kDa
Released: 16 May 2018

Explore 5NP2 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

5NP2 contains 2 α-helices and 19 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 1 helix, 10 β-strands

Element	Residues	Length	Sheet
β-strand	66-68	3	1
β-strand	72	1	2
β-strand	76	1	3
β-strand	79	1	4
β-strand	82	1	2
β-strand	87-88	2	1
β-strand	89-93	5	4
β-strand	99-104	6	4
β-strand	107-112	6	4
α-helix	113-115	3
β-strand	116-118	3	1

Chain B: 1 helix, 9 β-strands

Element	Residues	Length	Sheet
β-strand	65-68	4	5
β-strand	72	1	6
β-strand	76	1	3
β-strand	79	1	5
β-strand	82	1	6
β-strand	87-93	7	5
β-strand	99-104	6	5
β-strand	107-112	6	5
α-helix	113-115	3
β-strand	116-118	3	5

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Tyrosine-protein kinase ABL1	A, B	protein	61	Homo sapiens	P00519 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>5NP2_1 Tyrosine-protein kinase ABL1 (chains A, B)
GSHMNLFVALYDFVASGDNTLSITKGEKLRVLGYNHNGEWCEAQTKNGQGWVPSNYITPV
N

Primary citation

Structural insights into the tyrosine phosphorylation-mediated inhibition of SH3 domain-ligand interactions. Mero, B., Radnai, L., Gogl, G. et al. J Biol Chem (2019) 294:4608-4620. DOI 10.1074/jbc.RA118.004732 · PubMed

Other PDB entries of the same protein (UniProt P00519 (AlphaFold model), which also has an AlphaFold model), best resolution first:

5OAZ 1.03 Å, Crystal structure of the Abl-SH3 domain at pH 7.5
7PVS 1.05 Å, Crystal structure of the Abl SH3 domain V73E-A74S-S75R-G76T-D77E-G92N-Y93N-N94T-H95E…
4J9C 1.05 Å, Crystal structure of the Abl-SH3 domain H59Q-N96T mutant complexed with the designed…
4J9F 1.09 Å, Crystal structure of the Abl-SH3 domain complexed with the high affinity peptide P0
7PW2 1.1 Å, Crystal structure of the Abl SH3 domain V73E-A74S-S75R-G76T-D77E mutant
3EG3 1.4 Å, Crystal structure of the N114A mutant of ABL-SH3 domain
4J9E 1.4 Å, Crystal structure of the N114A mutant of the Abl-SH3 domain complexed with the high…
5DC4 1.48 Å, Crystal structure of monobody AS25/ABL1 SH2 domain complex, crystal a
4J9D 1.5 Å, Crystal structure of the N114A mutant of the Abl-SH3 domain complexed with the high…
5HU9 1.53 Å, Crystal structure of ABL1 in complex with CHMFL-074
7PVQ 1.55 Å, Crystal structure of the Abl SH3 domain V73E-A74S-S75R-G76T-D77E-G92N-Y93N-N94T-H95E…
5DC9 1.56 Å, Crystal structure of monobody AS25/ABL1 SH2 domain complex, crystal B

Browse structure collections

About this viewer

MolViewer shows 5NP2 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.