Crystal structure of the c-Src-SH3 domain Q128R mutant in complex with the high affinity peptide APP12. Determined by X-ray diffraction at 1.17 Å resolution. Released 12 Jul 2017.
Explore 5OB1 in 3D Show helices and sheets RCSB PDB PDBe
5OB1 contains 2 α-helices and 8 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 86-88 | 3 | 1 |
| β-strand | 92 | 1 | 2 |
| β-strand | 99 | 1 | 1 |
| β-strand | 102 | 1 | 2 |
| β-strand | 107-112 | 6 | 1 |
| β-strand | 118-123 | 6 | 1 |
| β-strand | 129-133 | 5 | 1 |
| α-helix | 134-136 | 3 | |
| β-strand | 137-139 | 3 | 1 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 2-11 | 10 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Proto-oncogene tyrosine-protein kinase Src | A | protein | 61 | Gallus gallus | P00523 (AlphaFold model) |
| APP12 | B | protein | 13 | synthetic construct |
>5OB1_1 Proto-oncogene tyrosine-protein kinase Src (chains A) GSHMTFVALYDYESRTETDLSFKKGERLQIVNNTEGDWWLAHSLTTGRTGYIPSNYVAPS D
>5OB1_2 APP12 (chains B) XAPPLPPRNRPRL
Crystal structure of the c-Src-SH3 domain Q128R mutant in complex with the high affinity peptide APP12. Camara-Artigas, A. To be published.
Other PDB entries of the same protein (UniProt P00523 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 5OB1 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.