5OHD: Growth hormone receptor

Putative inactive (dormant) dimeric state of GHR transmembrane domain. Determined by solution NMR. Released 11 Apr 2018.

Method: Solution NMR
Organism: Homo sapiens
Chains: 2
Atoms: 726
Mol. weight: 10.29 kDa
Released: 11 Apr 2018

Explore 5OHD in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

5OHD contains 3 α-helices and 0 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 2 helices, 0 β-strands

Element	Residues	Length	Sheet
α-helix	259-261	3
α-helix	268-290	23

Chain B: 1 helix, 0 β-strands

Element	Residues	Length	Sheet
α-helix	266-290	25

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Growth hormone receptor	A, B	protein	43	Homo sapiens	P10912 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>5OHD_1 Growth hormone receptor (chains A, B)
GSMSQFTCEEDFYFPWLLIIIFGIFGLTVMLFVFLFSKQQRIK

Primary citation

Structural basis of the signal transduction via transmembrane domain of the human growth hormone receptor. Bocharov, E.V., Lesovoy, D.M., Bocharova, O.V. et al. Biochim Biophys Acta (2018) 1862:1410-1420. DOI 10.1016/j.bbagen.2018.03.022 · PubMed

Other PDB entries of the same protein (UniProt P10912 (AlphaFold model), which also has an AlphaFold model), best resolution first:

1AXI 2.1 Å, Structural plasticity at the hgh:hghbp interface
1HWG 2.5 Å, 1:2 complex of human growth hormone with its soluble binding protein
1A22 2.6 Å, Human growth hormone bound to single receptor
1KF9 2.6 Å, Phage display derived variant of human growth hormone complexed with two copies of the…
2AEW 2.7 Å, A model for growth hormone receptor activation based on subunit rotation within a…
3HHR 2.8 Å, Human growth hormone and extracellular domain of its receptor: crystal structure of the…
1HWH 2.9 Å, 1:1 complex of human growth hormone mutant G120R with its soluble binding protein
5OEK Putative active dimeric state of GHR transmembrane domain

Browse structure collections

About this viewer

MolViewer shows 5OHD directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.