Structure of the A2A-StaR2-bRIL562-Compound 4e complex at 1.86A obtained from in meso soaking experiments (24 hour soak). Determined by X-ray diffraction at 2.0 Å resolution. Released 17 Jan 2018.
Explore 5OM4 in 3D Show helices and sheets RCSB PDB PDBe
5OM4 contains 24 α-helices and 2 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 2-33 | 32 | |
| α-helix | 35-37 | 3 | |
| α-helix | 40-54 | 15 | |
| α-helix | 55-59 | 5 | |
| α-helix | 60-67 | 8 | |
| β-strand | 71-73 | 3 | 1 |
| α-helix | 74-107 | 34 | |
| α-helix | 109-111 | 3 | |
| α-helix | 112-115 | 4 | |
| α-helix | 118-136 | 19 | |
| α-helix | 138-141 | 4 | |
| α-helix | 151-156 | 6 | |
| β-strand | 163-165 | 3 | 1 |
| α-helix | 168-171 | 4 | |
| α-helix | 174-175 | 2 | |
| α-helix | 176-187 | 12 | |
| α-helix | 188-1018 | 39 | |
| α-helix | 1023-1041 | 19 | |
| α-helix | 1060-1080 | 21 | |
| α-helix | 1084-1092 | 9 | |
| α-helix | 1094-1097 | 4 | |
| α-helix | 1098-1102 | 5 | |
| α-helix | 1103-258 | 44 | |
| α-helix | 263-266 | 4 | |
| α-helix | 267-291 | 25 | |
| α-helix | 293-306 | 14 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Adenosine receptor A2a,Soluble cytochrome b562,Adenosine receptor A2a | A | protein | 434 | Homo sapiens, Escherichia coli | P0ABE7 (AlphaFold model), P29274 (AlphaFold model) |
>5OM4_1 Adenosine receptor A2a,Soluble cytochrome b562,Adenosine receptor A2a (chains A) ADYKDDDDGAPPIMGSSVYITVELAIAVLAILGNVLVCWAVWLNSNLQNVTNYFVVSLAA ADILVGVLAIPFAITISTGFCAACHGCLFIACFVLVLAQSSIFSLLAIAIDRYIAIAIPL RYNGLVTGTRAAGIIAICWVLSFAIGLTPMLGWNNCGQPKEGKAHSQGCGEGQVACLFED VVPMNYMVYFNFFACVLVPLLLMLGVYLRIFAAARRQLADLEDNWETLNDNLKVIEKADN AAQVKDALTKMRAAALDAQKATPPKLEDKSPDSPEMKDFRHGFDILVGQIDDALKLANEG KVKEAQAAAEQLKTTRNAYIQKYLERARSTLQKEVHAAKSAAIIAGLFALCWLPLHIINC FTFFCPDCSHAPLWLMYLAIVLAHTNSVVNPFIYAYRIREFRQTFRKIIRSHVLRQQEPF KAAAHHHHHHHHHH
| ID | Name | Formula | Copies |
|---|---|---|---|
| OLC | (2R)-2,3-dihydroxypropyl (9Z)-octadec-9-enoate | C21 H40 O4 | 11 |
| OLA | Oleic acid | C18 H34 O2 | 16 |
| CLR | Cholesterol | C27 H46 O | 4 |
| T4E | 4-(3-amino-5-phenyl-1,2,4-triazin-6-yl)-2-chlorophenol | C15 H11 Cl N4 O | 1 |
Water and common crystallization additives (NA) are not listed.
Towards high throughput GPCR crystallography: In Meso soaking of Adenosine A2A Receptor crystals. Rucktooa, P., Cheng, R.K.Y., Segala, E. et al. Sci Rep (2018) 8:41-41. DOI 10.1038/s41598-017-18570-w · PubMed
Other PDB entries of the same protein (UniProt P0ABE7 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 5OM4 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.