5QSP: Cohesin subunit SA-1

PanDDA analysis group deposition -- Crystal Structure of human STAG1 in complex with Z2856434929. Determined by X-ray diffraction at 2.89 Å resolution. Released 21 Aug 2019.

Method: X-ray diffraction
Resolution: 2.89 Å
Organism: Homo sapiens
Chains: 2
Atoms: 7,079
Mol. weight: 105.75 kDa
Ligands: LVV
Released: 21 Aug 2019

Explore 5QSP in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

5QSP contains 50 α-helices and 0 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 26 helices, 0 β-strands

Element	Residues	Length
α-helix	460-474	15
α-helix	481-496	16
α-helix	499-507	9
α-helix	516-518	3
α-helix	519-538	20
α-helix	541-542	2
α-helix	551-553	3
α-helix	554-581	28
α-helix	586-592	7
α-helix	596-598	3
α-helix	603-606	4
α-helix	610-626	17
α-helix	630-644	15
α-helix	648-678	31
α-helix	685-702	18
α-helix	712-725	14
α-helix	731-754	24
α-helix	759-778	20
α-helix	779-781	3
α-helix	785-801	17
α-helix	804-807	4
α-helix	812-817	6
α-helix	823-832	10
α-helix	833-837	5
α-helix	856-877	22
α-helix	883-909	27

Chain B: 24 helices, 0 β-strands

Element	Residues	Length
α-helix	462-474	13
α-helix	478-480	3
α-helix	481-496	16
α-helix	499-507	9
α-helix	519-538	20
α-helix	556-582	27
α-helix	586-592	7
α-helix	596-598	3
α-helix	601-604	4
α-helix	610-626	17
α-helix	630-643	14
α-helix	651-676	26
α-helix	685-702	18
α-helix	712-724	13
α-helix	731-753	23
α-helix	759-779	21
α-helix	785-801	17
α-helix	804-806	3
α-helix	812-817	6
α-helix	820-822	3
α-helix	823-837	15
α-helix	857-877	21
α-helix	885-892	8
α-helix	901-910	10

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Cohesin subunit SA-1	A, B	protein	459	Homo sapiens	Q8WVM7 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>5QSP_1 Cohesin subunit SA-1 (chains A, B)
SMSPNGNLIRMLVLFFLESELHEHAAYLVDSLWESSQELLKDWECMTELLLEEPVQGEEA
MSDRQESALIELMVCTIRQAAEAHPPVGRGTGKRVLTAKERKTQIDDRNKLTEHFIITLP
MLLSKYSADAEKVANLLQIPQYFDLEIYSTGRMEKHLDALLKQIKFVVEKHVESDVLEAC
SKTYSILCSEEYTIQNRVDIARSQLIDEFVDRFNHSVEDLLQEGEEADDDDIYNVLSTLK
RLTSFHNAHDLTKWDLFGNCYRLLKTGIEHGAMPEQIVVQALQCSHYSILWQLVKITDGS
PSKEDLLVLRKTVKSFLAVCQQCLSNVNTPVKEQAFMLLCDLLMIFSHQLMTGGREGLQP
LVFNPDTGLQSELLSFVMDHVFIDQDEENQSMEGDEEDEANKIEALHKRRNLLAAFSKLI
IYDIVDMHAAADIFKHYMKYYNDYGDIIKETLSKTRQID

Ligands and cofactors

ID	Name	Formula	Copies
LVV	4-[(4-methylphenyl)methyl]-1,4-thiazinane 1,1-dioxide	C12 H17 N O2 S	1

Primary citation

PanDDA analysis group deposition. Newman, J.A., Katis, V.L., Gavard, A.E. et al. To be published.

Other PDB entries of the same protein (UniProt Q8WVM7 (AlphaFold model), which also has an AlphaFold model), best resolution first:

6QB5 2.02 Å, Crystal structure of the N-terminal region of human cohesin subunit STAG1
6R7O 2.31 Å, Crystal structure of the central region of human cohesin subunit STAG1
5QSX 2.34 Å, PanDDA analysis group deposition -- Crystal Structure of human STAG1 in complex with…
6RRC 2.37 Å, Crystal structure of the N-terminal region of human cohesin subunit STAG1 in complex…
5QSY 2.4 Å, PanDDA analysis group deposition -- Crystal Structure of human STAG1 in complex with…
5QSQ 2.48 Å, PanDDA analysis group deposition -- Crystal Structure of human STAG1 in complex with…
5QST 2.58 Å, PanDDA analysis group deposition -- Crystal Structure of human STAG1 in complex with…
5QSN 2.66 Å, PanDDA analysis group deposition -- Crystal Structure of human STAG1 in complex with…
5QSO 2.7 Å, PanDDA analysis group deposition -- Crystal Structure of human STAG1 in complex with…
5QSU 2.73 Å, PanDDA analysis group deposition -- Crystal Structure of human STAG1 in complex with…
5QSM 2.74 Å, PanDDA analysis group deposition -- Crystal Structure of human STAG1 in complex with…
5QSV 2.76 Å, PanDDA analysis group deposition -- Crystal Structure of human STAG1 in complex with…

Browse structure collections

About this viewer

MolViewer shows 5QSP directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.