5QSS: Cohesin subunit SA-1

PanDDA analysis group deposition -- Crystal Structure of human STAG1 in complex with Z33452282. Determined by X-ray diffraction at 3.08 Å resolution. Released 21 Aug 2019.

Method: X-ray diffraction
Resolution: 3.08 Å
Organism: Homo sapiens
Chains: 2
Atoms: 7,092
Mol. weight: 105.75 kDa
Ligands: O2P
Released: 21 Aug 2019

Explore 5QSS in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

5QSS contains 48 α-helices and 0 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 25 helices, 0 β-strands

Element	Residues	Length
α-helix	460-474	15
α-helix	481-488	8
α-helix	493-496	4
α-helix	499-507	9
α-helix	509-510	2
α-helix	519-538	20
α-helix	554-582	29
α-helix	586-592	7
α-helix	596-598	3
α-helix	603-606	4
α-helix	610-626	17
α-helix	630-645	16
α-helix	648-678	31
α-helix	685-702	18
α-helix	707-709	3
α-helix	712-725	14
α-helix	731-754	24
α-helix	759-779	21
α-helix	785-801	17
α-helix	804-807	4
α-helix	812-817	6
α-helix	823-836	14
α-helix	856-877	22
α-helix	883-893	11
α-helix	895-909	15

Chain B: 23 helices, 0 β-strands

Element	Residues	Length
α-helix	462-473	12
α-helix	481-497	17
α-helix	499-507	9
α-helix	519-538	20
α-helix	555-581	27
α-helix	586-592	7
α-helix	596-598	3
α-helix	602-605	4
α-helix	610-626	17
α-helix	630-643	14
α-helix	651-676	26
α-helix	685-704	20
α-helix	713-725	13
α-helix	731-753	23
α-helix	759-779	21
α-helix	785-801	17
α-helix	804-806	3
α-helix	812-817	6
α-helix	820-822	3
α-helix	823-837	15
α-helix	858-877	20
α-helix	890-892	3
α-helix	897-910	14

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Cohesin subunit SA-1	A, B	protein	459	Homo sapiens	Q8WVM7 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>5QSS_1 Cohesin subunit SA-1 (chains A, B)
SMSPNGNLIRMLVLFFLESELHEHAAYLVDSLWESSQELLKDWECMTELLLEEPVQGEEA
MSDRQESALIELMVCTIRQAAEAHPPVGRGTGKRVLTAKERKTQIDDRNKLTEHFIITLP
MLLSKYSADAEKVANLLQIPQYFDLEIYSTGRMEKHLDALLKQIKFVVEKHVESDVLEAC
SKTYSILCSEEYTIQNRVDIARSQLIDEFVDRFNHSVEDLLQEGEEADDDDIYNVLSTLK
RLTSFHNAHDLTKWDLFGNCYRLLKTGIEHGAMPEQIVVQALQCSHYSILWQLVKITDGS
PSKEDLLVLRKTVKSFLAVCQQCLSNVNTPVKEQAFMLLCDLLMIFSHQLMTGGREGLQP
LVFNPDTGLQSELLSFVMDHVFIDQDEENQSMEGDEEDEANKIEALHKRRNLLAAFSKLI
IYDIVDMHAAADIFKHYMKYYNDYGDIIKETLSKTRQID

Ligands and cofactors

ID	Name	Formula	Copies
O2P	N-(2-hydroxy-4-methylphenyl)-2-methylbenzamide	C15 H15 N O2	1

Primary citation

PanDDA analysis group deposition. Newman, J.A., Katis, V.L., Gavard, A.E. et al. To be published.

Other PDB entries of the same protein (UniProt Q8WVM7 (AlphaFold model), which also has an AlphaFold model), best resolution first:

6QB5 2.02 Å, Crystal structure of the N-terminal region of human cohesin subunit STAG1
6R7O 2.31 Å, Crystal structure of the central region of human cohesin subunit STAG1
5QSX 2.34 Å, PanDDA analysis group deposition -- Crystal Structure of human STAG1 in complex with…
6RRC 2.37 Å, Crystal structure of the N-terminal region of human cohesin subunit STAG1 in complex…
5QSY 2.4 Å, PanDDA analysis group deposition -- Crystal Structure of human STAG1 in complex with…
5QSQ 2.48 Å, PanDDA analysis group deposition -- Crystal Structure of human STAG1 in complex with…
5QST 2.58 Å, PanDDA analysis group deposition -- Crystal Structure of human STAG1 in complex with…
5QSN 2.66 Å, PanDDA analysis group deposition -- Crystal Structure of human STAG1 in complex with…
5QSO 2.7 Å, PanDDA analysis group deposition -- Crystal Structure of human STAG1 in complex with…
5QSU 2.73 Å, PanDDA analysis group deposition -- Crystal Structure of human STAG1 in complex with…
5QSM 2.74 Å, PanDDA analysis group deposition -- Crystal Structure of human STAG1 in complex with…
5QSV 2.76 Å, PanDDA analysis group deposition -- Crystal Structure of human STAG1 in complex with…

Browse structure collections

About this viewer

MolViewer shows 5QSS directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.