5QU1: Cytoplasmic protein NCK1

Crystal Structure of the monomeric human Nck SH3.1 domain, triclinic, 1.08A. Determined by X-ray diffraction at 1.08 Å resolution. Released 12 Feb 2020.

Method: X-ray diffraction
Resolution: 1.08 Å
Organism: Homo sapiens
Chains: 2
Atoms: 1,122
Mol. weight: 19.73 kDa
Released: 12 Feb 2020

Explore 5QU1 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

5QU1 contains 2 α-helices and 17 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 1 helix, 8 β-strands

Element	Residues	Length	Sheet
β-strand	3-7	5	1
β-strand	11	1	2
β-strand	18	1	1
β-strand	21	1	2
β-strand	26-31	6	1
β-strand	36-40	5	1
β-strand	46-50	5	1
α-helix	51-53	3
β-strand	54-55	2	1

Chain B: 1 helix, 9 β-strands

Element	Residues	Length	Sheet
β-strand	5-7	3	3
β-strand	11	1	4
β-strand	18	1	5
β-strand	21	1	4
β-strand	26-27	2	3
β-strand	28-31	4	5
β-strand	36-40	5	5
β-strand	46-50	5	5
α-helix	51-53	3
β-strand	54-56	3	3

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Cytoplasmic protein NCK1	A, B	protein	82	Homo sapiens	P16333 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>5QU1_1 Cytoplasmic protein NCK1 (chains A, B)
SGGLNDIFEAQKIEWHEGSENLYFQSEVVVVAKFDYVAQQEQELDIKKNERLWLLDDSKS
WWRVRNSMNKTGFVPSNYVERK

Primary citation

Small molecule AX-024 reduces T cell proliferation independently of CD3ε/Nck1 interaction, which is governed by a domain swap in the Nck1-SH3.1 domain. Richter, K., Rufer, A.C., Muller, M. et al. J Biol Chem (2020) 295:7849-7864. DOI 10.1074/jbc.RA120.012788 · PubMed

Other PDB entries of the same protein (UniProt P16333 (AlphaFold model), which also has an AlphaFold model), best resolution first:

5QU8 0.93 Å, Crystal Structure of symmetric swapped human Nck SH3.1 domain, 0.93A, orthorhombic form IV
5QU3 1.02 Å, Crystal Structure of domain swapped human Nck SH3.1, 1.01A, monoclinic
5QU2 1.04 Å, Crystal Structure of human Nck SH3.1 in complex with peptide PPPVPNPDY
5QU4 1.05 Å, Crystal Structure of swapped human Nck SH3.1 domain, 1.05A, orthorhombic form I
5QU5 1.11 Å, Domain Swap in the first SH3 domain of human Nck1
5QU7 1.27 Å, Crystal Structure of swapped human Nck SH3.1 domain, 1.3A, orthorhombic form III
2CI9 1.5 Å, Nck1 SH2-domain in complex with a dodecaphosphopeptide from EPEC protein Tir
5QUA 1.51 Å, Crystal Structure of swapped human Nck SH3.1 domain, 1.5A, C2221
2CI8 1.8 Å, sh2 domain of human nck1 adaptor protein - uncomplexed
5QU6 1.82 Å, Crystal Structure of swapped human Nck SH3.1 domain, 1.8A, triclinic
2CUB Solution structure of the SH3 domain of the human cytoplasmic protein Nck1
2JS0 Solution structure of second SH3 domain of adaptor Nck

Browse structure collections

About this viewer

MolViewer shows 5QU1 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.