PanDDA analysis group deposition -- CRYSTAL STRUCTURE OF THE BROMODOMAIN OF HUMAN NUCLEOSOME-REMODELING FACTOR SUBUNIT BPTF in complex with FMOPL000349a. Determined by X-ray diffraction at 1.13 Å resolution. Released 1 Apr 2020.
Explore 5R4L in 3D Show helices and sheets RCSB PDB PDBe
5R4L contains 9 α-helices and 2 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 2795-2799 | 5 | |
| β-strand | 2801 | 1 | 1 |
| α-helix | 2802 | 1 | |
| α-helix | 2804-2818 | 15 | |
| α-helix | 2824-2826 | 3 | |
| α-helix | 2829-2831 | 3 | |
| α-helix | 2838-2841 | 4 | |
| α-helix | 2848-2856 | 9 | |
| β-strand | 2862 | 1 | 1 |
| α-helix | 2863-2880 | 18 | |
| α-helix | 2886-2910 | 25 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Nucleosome-remodeling factor subunit BPTF | A | protein | 123 | Homo sapiens | Q12830 |
>5R4L_1 Nucleosome-remodeling factor subunit BPTF (chains A) SMSTEDAMTVLTPLTEKDYEGLKRVLRSLQAHKMAWPFLEPVDPNDAPDYYGVIKEPMDL ATMEERVQRRYYEKLTEFVADMTKIFDNCRYYNPSDSPFYQCAEVLESFFVQKLKGFKAS RSH
| ID | Name | Formula | Copies |
|---|---|---|---|
| RV4 | N-{4-[(morpholin-4-yl)methyl]phenyl}acetamide | C13 H18 N2 O2 | 1 |
Water and common crystallization additives (DMS, TRS) are not listed.
PanDDA analysis group deposition. Talon, R., Krojer, T., Fairhead, M. et al. To be published.
Other PDB entries of the same protein (UniProt Q12830), best resolution first:
MolViewer shows 5R4L directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.